Recombinant Bovine Neuronal acetylcholine receptor subunit beta-4 (CHRNB4)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

  • Gene Name: CHRNB4 (Bovine homolog of human CHRNB4) .

  • Protein Length: 477 amino acids (mature protein: residues 20–496) with a molecular weight of ~56.4 kDa .

  • Isoelectric Point (pI): Theoretical pI of 8.45 .

  • Domains: Contains extracellular N-terminal ligand-binding domains, four transmembrane helices, and cytoplasmic loops .

Functional Role in Nicotinic Signaling

CHRNB4 assembles with α subunits (e.g., α3, α4) to form heteropentameric nAChRs. Key functions include:

  • Ion Channel Activation: Binds acetylcholine, inducing conformational changes that open cation-conducting channels .

  • Nicotine Dependence: β4-containing receptors in the habenula-interpeduncular pathway mediate nicotine aversion .

  • Trafficking Regulation: The β4 subunit enhances α3 subunit incorporation into functional receptors via its ER export motif .

Recombinant Production Workflow

StepMethod/Details
CloningFull-length bovine CHRNB4 codon-optimized
ExpressionE. coli (e.g., BL21 strains)
PurificationImmobilized metal affinity chromatography (IMAC)
ValidationWestern blot, ligand-binding assays

Research Applications

ApplicationUse CaseCitation
ElectrophysiologyStudying ion channel kinetics
Addiction StudiesRole in nicotine/alcohol dependence
Structural BiologyCryo-EM studies of receptor assembly
Antibody DevelopmentGenerating subunit-specific probes

Table 1: Functional Insights from Studies

Study FocusKey ResultSystemCitation
Promoter ActivityCA box motif critical for CHRNB4 transcriptionTransgenic mice
Nicotine Aversionβ4 overexpression reduces nicotine consumptionLentiviral MHb injection
Ethanol ResponsesNo significant role in ethanol behaviorsChrnb4 KO mice
Receptor Traffickingβ4 enhances α3β4 surface expressionHEK293 cells

Challenges and Limitations

Future Directions

  • High-Resolution Structures: Cryo-EM studies of bovine α3β4 receptors.

  • Gene Editing: CRISPR-based models to explore CHRNB4 polymorphisms in addiction.

  • Therapeutic Targeting: Designing β4-selective modulators for nicotine cessation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order remarks. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
CHRNB4; ACRB4; Neuronal acetylcholine receptor subunit beta-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-496
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
CHRNB4
Target Protein Sequence
DCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIQLQLSLAQLISVNEREQIMTTNI WLKQEWTDYRLAWNSSRYEGVNILRIPANRVWLPDIVLYNNADGSYEVSLYTNVVVRSNG SVMWLPPAICKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKMPTASMDDFTPSG EWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSD CGEKMTLCISVLLALTVFLLLISKIVPPTSLNVPLIGKYLMFTMVLVTFSIVTSVCVLNV HHRSPSTHTMAPWVKRCFLHKLPTFLFIKRPRQQPSRAPQSSLARLTKSEATTTTTLAMG PTSSSNLYGNSMYFVNPGLAAPKSPVASDSAGIPRDFRLRSSGRFRQDVQEALEGVSFIA QHMKSDDLDQSVIEDWKYVAMVVDRLFLWVFVVVCVLGTVGLFLPPLFQTHTPSEEP
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change that affects all subunits. This change leads to the opening of an ion-conducting channel across the plasma membrane.
Gene References Into Functions
  1. Research indicates that a basic residue at position 210 of the beta4 subunit slightly reduces alpha3beta4 receptor expression. PMID: 21420959
  2. Bovine chromaffin cells express nicotinic alpha3beta4 acetylcholine receptors. PMID: 12438106
  3. Bovine chromaffin cells contain an alpha3alpha7beta4 nicotinic receptor. PMID: 12438113
Database Links

KEGG: bta:282181

STRING: 9913.ENSBTAP00000048228

UniGene: Bt.9978

Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-4/CHRNB4 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of the CHRNB4 subunit?

CHRNB4 is one of the beta subunits of the nicotinic acetylcholine receptor superfamily. The protein contains an extracellular amino terminus and four transmembrane domains. Following acetylcholine binding, the receptor undergoes an extensive conformational change affecting all subunits, which leads to the opening of an ion-conducting channel across the plasma membrane . This structure is highly conserved across mammalian species, including bovine variants, making it an important target for comparative research examining receptor function across different animal models.

How does CHRNB4 contribute to functional nAChR channels?

CHRNB4 typically assembles with other nAChR subunits to form heteromeric pentameric structures. Most commonly, it associates with the alpha-3 subunit (forming α3β4 receptors), particularly in the peripheral nervous system and specific brain regions. These heteromeric structures contain both alpha and beta subunits arranged in a specific stoichiometry to form functional receptor complexes . The β4 subunit is often rate-limiting for receptor activity, making it a crucial determinant of channel properties and nicotine response characteristics .

What are the primary regions of CHRNB4 expression in the nervous system?

CHRNB4 demonstrates region-specific expression patterns in the nervous system. Studies using β4 promoter/lacZ transgenic animals have shown expression in numerous brain regions, particularly in the medial habenula (MHb) and interpeduncular nucleus (IPN) of the habenulo-interpeduncular (Hb-IPN) tract, which is enriched in α3β4 nAChRs . Additional expression has been observed in the pineal gland and superior cervical ganglion, where coordinate expression with the α3 gene has been demonstrated . The expression patterns are regulated through specific transcriptional control elements including the CA box and conserved non-coding region #4 (CNR4) .

What expression systems are most effective for recombinant CHRNB4 production?

For recombinant expression of functional CHRNB4, mammalian expression systems typically yield the best results due to their appropriate post-translational modification capabilities. Common cell lines include HEK293, SH-SY5Y, and Neuro-2a cells, which have been demonstrated to express functional nAChRs when transfected with appropriate subunit combinations. For experimental validation of promoter constructs, neuronal-like cell lines such as Neuro-2a and SN17 have been successfully used to assess β4 promoter activity . When expressing recombinant bovine CHRNB4, codon optimization for the expression system may improve protein yields.

How can recombinant CHRNB4 be effectively co-expressed with partner subunits?

For functional studies, CHRNB4 must typically be co-expressed with appropriate alpha subunits, most commonly α3. Effective co-expression protocols include:

  • Dual plasmid transfection with optimized α:β ratios (typically 1:1 or 1:2)

  • Bicistronic expression vectors containing both subunit genes

  • Viral delivery systems such as lentiviruses for in vivo expression

Studies have confirmed that lentiviral-mediated expression of β4 specifically upregulates α3β4 but not β2 nAChRs in regions like the medial habenula . This targeted approach allows for selective enhancement of specific receptor subtypes for functional analysis.

What purification strategies yield functional CHRNB4-containing receptors?

Purification of membrane proteins like CHRNB4 requires specialized approaches:

  • Detergent solubilization using mild detergents (CHAPS, DDM, or Triton X-100)

  • Affinity chromatography using tagged recombinant proteins (His-tagged or FLAG-tagged)

  • Immunoaffinity purification using subunit-specific antibodies

For immunoprecipitation and purification applications, validated antibodies against CHRNB4 are commercially available, such as those raised against synthetic peptides derived from CHRNB4 protein . These antibodies have been confirmed to react with CHRNB4 and can be used for applications including ELISA, immunofluorescence, and Western blotting at appropriate dilutions .

What key regulatory elements control CHRNB4 expression?

Research has identified several critical regulatory elements controlling CHRNB4 expression:

  • CA box regulatory element (5′-CCACCCCT–3′): This element is crucial for β4 promoter activity both in vitro and in vivo. Mutation of this element virtually eliminates promoter activity, demonstrating its essential role in transcriptional control .

  • Conserved non-coding region #4 (CNR4): Located approximately 30-kb upstream of the β4 gene, this element contains regulatory information needed to direct expression of the β4 gene to specific regions including the pineal gland and interpeduncular nucleus. It functions as a locus control region-like regulatory domain that mediates the coordinate expression of the β4 and α3 genes .

The following table summarizes experimental findings regarding the CA box regulatory element:

Regulatory ElementSequenceEffect of MutationAffected Brain RegionsTranscription Factor
CA box5′-CCACCCCT–3′Virtually eliminates promoter activityMultiple CNS and PNS regionsSp1
Mutant CA box5′-CCAGCGCA–3′No expression at ED18.5, drastically reduced at PD30All regions that endogenously express β4Reduced Sp1 binding

How does the transcription factor Sp1 regulate CHRNB4 expression?

Sp1 has been identified as a critical transcription factor that interacts with the CA box in the CHRNB4 promoter. Experimental evidence has demonstrated that:

  • Mutation of the CA box results in decreased interaction of Sp1 with the mutant β4 promoter

  • The decreased Sp1 binding correlates with dramatically reduced promoter activity

  • Sp1 plays a crucial role in directing the positive transcriptional regulatory effect of the CA box in vivo

This interaction represents a key mechanism in the regulatory cascade that ensures accurate expression of the β4 gene, allowing nAChRs containing the β4 subunit to participate in both normal physiological processes and tobacco-related pathological conditions .

What methods are most effective for studying CHRNB4 promoter activity?

Several complementary approaches have proven effective for studying CHRNB4 promoter activity:

  • In vitro reporter assays: Using cell lines such as Neuro-2a and SN17 with wild-type and mutant promoter constructs driving reporter gene expression (e.g., lacZ)

  • Transgenic mouse models: Generation of transgenic mice expressing reporter genes (e.g., lacZ) under control of wild-type or mutant β4 promoters to examine spatial and temporal expression patterns

  • Chromatin immunoprecipitation (ChIP): To detect binding of transcription factors like Sp1 to the promoter region in native chromatin contexts

  • Quantitative PCR: For determining transgene copy number and expression levels in different experimental models

How do specific CHRNB4 genetic variants affect receptor function?

Several single nucleotide polymorphisms (SNPs) in CHRNB4 have been identified that significantly alter receptor function. Key variants that have been functionally characterized include:

CHRNB4 VariantEffect on Nicotine-Evoked CurrentsAssociation with Nicotine DependenceFunctional Category
β4A90ISignificantly increasedReduced risk of smokingGain-of-function
β4T374ISignificantly increasedReduced risk of smokingGain-of-function
β4D447YSignificantly increasedNot specifiedGain-of-function
β4R348CReducedAssociated with sporadic ALSLoss-of-function

These variants demonstrate how specific amino acid substitutions can dramatically alter receptor channel properties and associated behaviors related to nicotine consumption .

What experimental methods can effectively characterize functional differences between CHRNB4 variants?

Several approaches have proven valuable for characterizing functional differences between CHRNB4 variants:

  • Electrophysiological recordings: Co-expression of CHRNB4 variants with alpha subunits (typically α3) followed by patch-clamp recording to measure nicotine-evoked current amplitudes

  • Lentiviral expression in specific brain regions: Targeted expression of specific CHRNB4 variants in regions such as the medial habenula, followed by behavioral testing

  • Nicotine consumption studies: Assessment of nicotine preference or aversion in animal models expressing different CHRNB4 variants

  • Immunoprecipitation studies: Confirmation of specific upregulation of particular nAChR subtypes (e.g., α3β4 but not β2) following expression of CHRNB4 variants

These approaches have confirmed that gain-of-function variants like β4T374I can induce strong nicotine aversion when expressed in the habenula, while loss-of-function variants like β4R348C fail to induce such aversion .

How do CHRNB4 polymorphisms contribute to nicotine dependence risk?

Research has established clear links between specific CHRNB4 polymorphisms and altered risk for nicotine dependence. The CHRNA5-CHRNA3-CHRNB4 gene cluster has been consistently linked to nicotine dependence in genome-wide association studies . Specific mechanisms include:

  • Gain-of-function variants (β4A90I, β4T374I) associate with reduced risk of smoking, likely through enhanced aversive effects of nicotine

  • These variants produce significantly increased nicotine-evoked current amplitudes when co-expressed with α3 subunits

  • Habenular expression of these variants results in strong aversion to nicotine in animal models

  • Loss-of-function variants may reduce the aversive properties of nicotine, potentially increasing vulnerability to nicotine dependence

These findings highlight the critical role of habenular β4-containing receptors in regulating nicotine consumption and dependence risk.

What are the optimal electrophysiological protocols for studying CHRNB4-containing receptors?

Electrophysiological characterization of CHRNB4-containing receptors requires specific protocols tailored to their properties:

  • Whole-cell patch-clamp recordings: Optimal for measuring current amplitudes in response to specific agonist concentrations, using:

    • Holding potential typically between -60 to -80 mV

    • Fast perfusion systems for rapid agonist application

    • Careful consideration of desensitization kinetics when designing stimulus protocols

  • Single-channel recordings: For detailed analysis of:

    • Channel conductance

    • Open probability

    • Mean open time

    • Bursting behavior

  • Voltage-clamp protocols: To characterize:

    • Current-voltage relationships

    • Voltage-dependent gating

    • Calcium permeability using ion substitution methods

These approaches have been successfully employed to demonstrate that specific variants like β4A90I, β4T374I, and β4D447Y significantly alter nicotine-evoked current amplitudes .

How can CHRNB4 be targeted for therapeutic development in nicotine addiction?

The critical role of CHRNB4 in nicotine response makes it a valuable target for therapeutic development:

  • Habenular targeting: The medial habenula has been identified as a critical site where modulation of β4-containing receptors alters nicotine consumption. Mice with habenular expression of β4 or gain-of-function β4 variants show pronounced aversion to nicotine

  • Allosteric modulators: Development of positive allosteric modulators of α3β4 receptors may enhance the aversive properties of nicotine, potentially reducing consumption

  • Variant-inspired pharmacology: Structural insights from gain-of-function variants like β4A90I and β4T374I can inform development of compounds that mimic these enhanced functional states

  • Region-specific intervention: Methods for selectively targeting habenular β4-containing receptors, such as viral-mediated gene delivery, represent promising approaches for addiction treatment

What are the implications of CHRNB4 research beyond nicotine dependence?

CHRNB4 research has implications beyond nicotine dependence, including:

  • Neurological disorders: The β4R348C variant has been identified as the mutation most frequently encountered in sporadic amyotrophic lateral sclerosis (sALS), suggesting potential roles in neurodegeneration

  • Cancer susceptibility: Genome-wide association studies have linked the CHRNA5-CHRNA3-CHRNB4 gene cluster to lung cancer susceptibility as well as nicotine dependence

  • Pain processing: β4-containing receptors may play roles in specific pain transmission pathways

  • Developmental neurobiology: The precise regulation of CHRNB4 expression during development suggests important roles in circuit formation and maturation, with the CA box regulatory element being critical for β4 promoter activity at both embryonic day 18.5 and postnatal day 30

These diverse implications underscore the importance of continuing research on CHRNB4 structure, function, and regulation across species, including bovine models that may offer comparative insights into conserved mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.