Recombinant Bovine Neuropeptide Y receptor type 1 (NPY1R)

Shipped with Ice Packs
In Stock

Description

Key Ligand Binding Properties

LigandAffinity Rank (High → Low)Receptor Specificity
NPY1Non-selective agonist
[Pro-34] PYY2Partial agonist
PYY3Endogenous agonist
[Leu-31, Pro-34] NPY4Synthetic agonist

Functional Roles and Signaling Pathways

Recombinant bovine NPY1R mediates diverse physiological processes through Gαi/o-coupled pathways:

Metabolic Regulation

  • Adipogenesis: NPY1R activation promotes adipocyte differentiation and visceral fat accumulation, particularly under high-fat diet conditions .

  • Glucose homeostasis: Knockout studies show impaired glucose clearance in diet-induced obesity models .

Neuromodulation

  • Anxiolytic effects: Hippocampal overexpression reduces anxiety-like behavior in rodents .

  • Pain modulation: Inhibits neuropathic pain via spinal dorsal horn interneurons .

Immune Modulation

  • Anti-inflammatory action: Suppresses pro-inflammatory cytokines (e.g., TNF-α, IL-1β) in microglia and macrophages via Y1R activation .

  • Cell migration: Enhances dendritic cell chemotaxis through ERK/p38 MAPK pathways .

Pharmacological Studies

  • Antagonist development: Non-peptide antagonists like BIBO-3304 (CAS# 191868-14-1) and BIBP-3226 (CAS# 159013-54-4) are used to study receptor inhibition .

  • Agonist screening: Peptide YY and synthetic analogs are employed to probe ligand-receptor interactions .

In Vitro Models

  • LX-2 hepatic stellate cells: NPY1R activation via mTOR/p70S6K/4EBP1 signaling promotes fibrogenic responses (proliferation, migration) .

  • RAW264.7 macrophages: NPY-Y1R axis upregulates HMGB1, exacerbating inflammation .

In Vivo Models

Model SystemKey FindingMechanism
Npy1r-knockout mice Increased HFD-induced obesityImpaired energy homeostasis
rAAV-Y1 hippocampal mice Anxiolytic effects observedY1R overexpression
Neuropathic pain models Mechanical allodynia reductionSpinal Y1-IN inhibition

Clinical and Therapeutic Implications

  • Liver disease: Elevated serum NPY correlates with hepatic dysfunction in cirrhosis .

  • Neuropsychiatric disorders: Y1R agonists show potential for anxiety and depression treatment .

  • Immune disorders: Targeting Y1R may modulate chronic inflammation .

Detection and Validation Tools

  • Antibodies: Polyclonal antibodies (e.g., bs-1070R) target epitopes in the C-terminal region (aa 301–382) .

  • qPCR primers: Designed for bovine Npy1r mRNA quantification (e.g., Y1R-FW: TTCTCCCTCCAGTGACACTC) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NPY1R; Neuropeptide Y receptor type 1; NPY1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MNSTSFSQVENHSIYYNFSEKNSRFLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLA LIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQ CVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVLT DEPFQNVTLDAFKDKYVCFDKFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYVRLKR RNSMMDKMRDNKYRSSEAKRINIMLLSIVVAFAVCWLPLTIFNTVFDWDHQIIATCNHNL LFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFSFCDFRSRDDDYETIAMSTMHTDVS KTSLKQASPVALKKIHTDDNEKI
Uniprot No.

Target Background

Function
Receptor for neuropeptide Y and peptide YY.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Neuropeptide Y Receptor Type 1 (NPY1R)?

NPY1R is a G-protein coupled receptor (GPCR) that belongs to the class A or rhodopsin-like GPCR family. It consists of 384 amino acids in humans and functions primarily by coupling to inhibitory G proteins (Gi/o). NPY1R serves as a receptor for neuropeptide Y (NPY) and peptide YY (PYY), with lower affinity for pancreatic polypeptide (PP) .

The receptor plays crucial roles in:

  • Regulation of feeding behavior and energy homeostasis

  • Vasoconstriction in peripheral tissues

  • Modulation of anxiety and stress responses

  • Neurogenesis and cognitive functions

  • Pain perception and modulation

Key structural features include:

  • Seven transmembrane domains characteristic of GPCRs

  • Critical binding residues including Asp2.68, Asp6.59, Tyr2.64, Phe6.58, and His7.31

  • N-terminal domain that, while not directly participating in the binding pocket, is essential for membrane expression

What expression systems are commonly used for producing recombinant NPY1R?

Several expression systems have been successfully employed for recombinant NPY1R production:

Expression SystemAdvantagesYieldApplications
E. coliCost-effective, rapid productionModeratePeptide fragments, antigens
Mammalian cellsProper folding, post-translational modificationsHighFunctional studies, binding assays
Insect cells (Sf9)High yield, proper foldingVery highStructural studies, crystallography
Wheat germ cell-freeRapid production, eukaryotic processingModerateFull-length protein production

For functional studies requiring properly folded and post-translationally modified NPY1R, mammalian or insect cell expression systems are recommended. For example, baculovirus expression systems using Spodoptera frugiperda (Sf) cells have been successfully used for crystallography studies of human NPY1R .

How can I validate the expression and functionality of recombinant bovine NPY1R?

Validation should include multiple complementary approaches:

  • Expression validation:

    • Western blot using antibodies against NPY1R or epitope tags

    • Flow cytometry for surface expression in intact cells

    • Immunofluorescence microscopy for localization studies

  • Functional validation:

    • Ligand binding assays using radiolabeled or fluorescently labeled NPY

    • NanoBRET-based binding assays that can detect high- and low-affinity binding states

    • G protein activation assays (GTPγS binding, BRET-based G protein dissociation)

    • Downstream signaling assays (cAMP inhibition, calcium mobilization, ERK phosphorylation)

  • Pharmacological validation:

    • Dose-response curves with known agonists ([Leu31, Pro34]NPY) and antagonists

    • Competitive binding studies with selective ligands

    • Comparison of pharmacological parameters (Ki, EC50, Emax) with published values

For NanoBRET-based binding assays, a nanoluciferase fused to the N-terminus of the receptor serves as an energy donor, while a fluorophore-tagged peptide ligand acts as an acceptor, allowing direct measurement of ligand affinities across multiple orders of magnitude .

What are the key considerations for designing site-directed mutagenesis studies of bovine NPY1R to investigate species-specific ligand binding properties?

When designing site-directed mutagenesis studies for bovine NPY1R, consider:

  • Comparative sequence analysis:

    • Align bovine NPY1R with human, rodent, and other mammalian orthologs to identify divergent residues

    • Focus on extracellular loops and transmembrane domains involved in ligand binding

  • Key residues to target based on human NPY1R studies:

    • Asp2.68 and Asp6.59: Essential for electrostatic interactions (mutation to Ala reduces affinity)

    • Tyr2.64, Phe6.58, and His7.31: Form a hydrophobic pocket critical for ligand binding

    • Arg35 of NPY interacts with Asp6.59, representing a confirmed binding interaction

  • Functional assessment methodology:

    • Implement NanoBRET-based binding assays which can detect both high- and low-affinity states

    • For human NPY1R, these states showed dissociation constants of KD,1= 4.0 nM and KD,2= 126 nM

    • Analyze changes in both binding affinity and maximal BRET signal (BRETmax) which can indicate altered binding poses

  • Controls and validation:

    • Include positive controls (wild-type receptor) and negative controls (non-transfected cells)

    • Validate expression levels of mutants by surface ELISA or flow cytometry to normalize binding data

    • Use multiple selective ligands to fully characterize pharmacological profiles of mutants

Mutations in key residues like D200A, R2085.35A, and F2866.58A in human NPY1R have been shown to reduce the BRET window of the high-affinity state, suggesting destabilization of the peptide-receptor-G protein complex .

How can I optimize experimental conditions for investigating NPY1R-GALR2 heterodimer formation in bovine neural tissues?

Recent research has identified functional interactions between NPY1R and Galanin Receptor 2 (GALR2) in the dentate gyrus of the hippocampus . To investigate potential heterodimer formation in bovine neural tissues:

  • Tissue preparation and optimization:

    • Fresh tissue isolation with minimal post-mortem interval

    • Optimization of membrane preparation protocols using different buffer compositions

    • Comparison of crude membrane fractions versus purified membrane preparations

  • Detection of heterodimers using proximity-based approaches:

    • In situ proximity ligation assay (PLA): This technique has successfully demonstrated NPY1R-GALR2 co-localization in rodent hippocampal dentate gyrus. Use specific antibodies against NPY1R and GALR2 (e.g., rabbit anti-GALR2 and goat anti-NPY1R)

    • BRET/FRET assays: Express differentially tagged receptors (e.g., NPY1R-Rluc and GALR2-YFP) in native or recombinant systems

    • Time-resolved FRET: Offers improved signal-to-noise ratio for detecting protein-protein interactions

  • Functional validation of heterodimers:

    • Co-administration of NPY1R and GALR2 agonists (e.g., [Leu31, Pro34]NPY and M1145) to assess synergistic effects on:

      • Cell proliferation markers (PCNA, DCX)

      • Signaling pathways unique to the heterodimer

      • Neurogenesis in hippocampal preparations

  • Controls to validate specificity:

    • Use GALR2 antagonists (e.g., M871) to confirm specificity of interactions

    • Include non-dimerizing receptor pairs as negative controls

    • Employ receptor-selective siRNA to confirm specificity of antibody detection

In rodent studies, combined administration of M1145 (GALR2 agonist) and NPY1R agonist significantly increased PCNA-positive cells in the subgranular zone of the dentate gyrus, with this effect being blocked by the GALR2 antagonist M871 .

What are the methodological considerations for investigating NPY1R-mediated signaling in bovine hypothalamic neurons related to energy homeostasis?

When studying NPY1R signaling in bovine hypothalamic neurons in the context of energy homeostasis:

  • Tissue/cell preparation options:

    • Primary hypothalamic neuron cultures from bovine fetal or neonatal brain

    • Hypothalamic slice preparations for ex vivo studies

    • Hypothalamic explant cultures maintaining 3D architecture

    • Immortalized bovine hypothalamic cell lines (if available)

  • Key signaling pathways to investigate:

    • Gi/o-mediated inhibition of adenylyl cyclase (measured by cAMP assays)

    • MAPK/ERK activation (Western blot for phospho-ERK)

    • Calcium mobilization (fluorescent calcium indicators)

    • β-arrestin recruitment (BRET-based assays)

    • Electrophysiological responses (patch-clamp recording)

  • Experimental design for energy homeostasis studies:

    • Compare NPY1R expression and signaling under different metabolic conditions:

      • Fed vs. fasted states

      • Normal vs. high-fat diet exposure

      • Different dairy cow genotypes that may affect expression profiles

    • Use selective NPY1R agonists (e.g., [Leu31, Pro34]NPY) and antagonists

  • Data integration and analysis:

    • Correlate NPY1R expression with metabolic parameters

    • Consider breed differences in expression profiles (relevant for bovine studies)

    • Examine differential responses in distinct hypothalamic nuclei

Research has shown that conditional inactivation of the Npy1r gene in hippocampal excitatory neurons decreased body weight growth and adipose tissue on normal diet regimens, while exposure to high-fat diet resulted in increased caloric intake, body weight growth, and abdominal adipose tissue in mutant mice .

How can I develop a reliable in vitro model to study the role of bovine NPY1R in vasoconstriction for cardiovascular research?

To develop an in vitro model for studying bovine NPY1R in vasoconstriction:

  • Tissue preparation options:

    • Isolated bovine blood vessel segments (e.g., coronary, mesenteric arteries)

    • Primary bovine vascular smooth muscle cells (BVSMCs)

    • Bovine endothelial cell cultures

    • Co-culture systems incorporating multiple vascular cell types

  • Functional assays for vasoconstriction:

    • Wire myography: Measures isometric tension in isolated vessel rings

    • Pressure myography: Assesses changes in vessel diameter under physiological pressure

    • Calcium imaging: Monitors intracellular calcium mobilization in VSMCs

    • Impedance-based systems: Tracks cellular contraction in real-time

  • Molecular characterization:

    • NPY1R expression quantification by qPCR and Western blot

    • Signaling pathway analysis focusing on pathways mediating vasoconstriction:

      • Phospholipase C/IP3/calcium mobilization

      • RhoA/ROCK pathway activation

      • Myosin light chain phosphorylation

  • Pharmacological validation:

    • Dose-response curves with NPY and selective NPY1R agonists

    • Antagonist studies to confirm receptor specificity

    • Comparison with established vasoconstrictors (e.g., angiotensin II, endothelin-1)

  • Physiological relevance:

    • Investigation of NPY1R-mediated responses under different oxygen tensions

    • Effects of inflammatory mediators on NPY1R-induced vasoconstriction

    • Interaction with other vasoactive systems

NPY exerts vasoconstrictor/pressor effects via NPY1R in the periphery, contrasting with its potential anti-hypertensive actions in the CNS . Mice with NPY1R knockout display changes in adrenergic activity, including increased catecholamine biosynthesis and secretion .

What approaches should I consider when investigating genetic variations in bovine NPY1R and their potential impact on production traits in dairy cattle?

When studying genetic variations in bovine NPY1R:

  • Genomic analysis approaches:

    • Targeted sequencing of NPY1R coding regions, regulatory elements, and UTRs

    • Genome-wide association studies (GWAS) correlating SNPs with production traits

    • Whole genome sequencing for comprehensive variant identification

    • RNA-seq to assess expression differences associated with variants

  • Key regions to analyze based on human studies:

    • Promoter region: Variants like A-585T can affect transcriptional regulation

    • 3'-UTR: Variants like A+1050G can influence post-transcriptional regulation and have been associated with autonomic function

    • Coding region: Focus on variants affecting key binding residues identified in structural studies

  • Functional validation of variants:

    • Luciferase reporter assays for promoter and UTR variants

    • CRISPR/Cas9 gene editing to introduce variants in cell models

    • Electrophoretic mobility shift assays (EMSA) to assess transcription factor binding

  • Production traits to correlate with NPY1R variants:

    • Feed intake and efficiency

    • Milk production parameters (yield, fat and protein content)

    • Body condition score and adiposity

    • Stress responses and reproductive performance

  • Breed-specific considerations:

    • Compare NPY1R variants across different cattle breeds

    • Assess different dairy genotypes (e.g., Holstein-Friesian, Jersey, crossbreeds) as they may have varying expression profiles

A study on human NPY1R found that variants in the 3'-UTR (A+1050G) influenced autonomic traits including baroreceptor function and blood pressure response to environmental stress, while promoter variant A-585T interacted with the 3'-UTR variant to determine blood pressure .

What are the common challenges in expressing functional recombinant bovine NPY1R and how can they be overcome?

Common challenges and solutions include:

ChallengePotential CausesSolutions
Low expression levelsPoor codon optimization, toxic to host cellsOptimize codons for expression system, use inducible promoters, lower expression temperature
Improper foldingHydrophobic transmembrane domains, lack of chaperonesUse specialized expression systems (insect cells, mammalian cells), add chemical chaperones (DMSO, glycerol)
Aggregation in inclusion bodiesOverexpression, improper foldingReduce expression rate, optimize solubilization conditions, use fusion tags (MBP, SUMO)
Poor membrane localizationMissing trafficking signals, improper foldingAdd trafficking tags, verify N-terminal integrity (at least 8 residues are needed for membrane expression)
Low functionalityImproper post-translational modificationsSwitch to mammalian expression systems, verify glycosylation status
Instability during purificationDetergent sensitivity, proteolysisTest multiple detergents (DDM, LMNG), add protease inhibitors, optimize buffer composition

When expressing NPY1R for structural studies, researchers have successfully used:

  • Modified constructs with T4 Lysozyme inserted at ICL3 (between R241 and D250)

  • C-terminal truncations (removing V359-I384) to improve protein yield and stability

  • Addition of N-terminal tags (HA signal peptide, Flag epitope)

How can I resolve inconsistent results in NPY1R binding assays?

When troubleshooting inconsistent binding assay results:

  • Common sources of variability:

    • Receptor expression level differences between experiments

    • Ligand degradation or aggregation

    • Buffer composition affecting binding kinetics

    • Temperature fluctuations during assay

  • Technical solutions:

    • Use internal standards for normalization across experiments

    • Prepare fresh ligand solutions for each experiment

    • Control temperature strictly throughout the assay

    • Optimize binding buffer composition (pH, ionic strength, presence of divalent cations)

  • Specific considerations for NPY1R:

    • Account for biphasic binding curves: NPY1R typically displays two affinity states (KD,1= 4.0 nM and KD,2= 126 nM for human NPY1R)

    • Verify G protein coupling status: The high-affinity state is G protein-dependent

    • Test multiple ligand concentrations spanning both affinity states

    • Consider radioligand vs. fluorescence-based assays: Validate results using complementary methods

  • Data analysis recommendations:

    • Use appropriate binding models (one-site, two-site, allosteric)

    • Perform replicate experiments to assess reproducibility

    • Consider statistical approaches for handling outliers

The biphasic nature of binding curves should be verified as a genuine property of the receptor rather than an artifact by testing different positions of the fluorophore on the ligand .

What strategies can help resolve difficulties in detecting NPY1R protein expression in bovine tissue samples?

When facing challenges in detecting NPY1R in bovine tissues:

  • Sample preparation optimization:

    • Test multiple protein extraction methods: RIPA buffer, membrane fractionation, specialized GPCR extraction kits

    • Prevent proteolysis: Use fresh samples, include multiple protease inhibitors

    • Optimize fixation for IHC/IF: Test different fixatives (PFA vs. methanol) and fixation times

  • Antibody-related solutions:

    • Evaluate multiple antibodies: Test antibodies targeting different epitopes of NPY1R

    • Cross-species validation: Verify if antibodies raised against human or rodent NPY1R recognize bovine orthologs

    • Custom antibody development: Consider generating antibodies against bovine-specific peptide sequences

    • Epitope retrieval optimization: Test multiple antigen retrieval methods for fixed tissues

  • Signal amplification strategies:

    • Tyramide signal amplification for immunohistochemistry

    • Proximity ligation assay (PLA) for increased sensitivity and specificity

    • Highly sensitive detection systems (e.g., ECL Prime, SuperSignal West Femto for Western blots)

  • Alternative detection approaches:

    • mRNA detection: Use in situ hybridization or qPCR when protein detection is challenging

    • Functional assays: Assess receptor presence through ligand binding or signaling responses

    • Receptor autoradiography: Use radiolabeled NPY to visualize binding sites in tissue sections

NPY1R has been successfully detected in various tissues, including hippocampal subregions (CA1, CA3, dentate gyrus) , retinal cells (neurons, Müller cells, astrocytes, microglia) , and breast cancer tissues .

How should I interpret differences in NPY1R binding affinities between species when developing bovine-specific pharmacological tools?

When interpreting cross-species differences in NPY1R pharmacology:

  • Systematic analysis approach:

    • Generate comprehensive concentration-response curves for multiple ligands

    • Calculate and compare binding parameters (Kd, Ki) and functional parameters (EC50, Emax)

    • Create selectivity profiles comparing affinity/potency ratios across receptors and species

  • Key parameters to analyze:

    • Binding affinity shifts: Quantify fold-differences in Kd/Ki values between species

    • Efficacy differences: Compare maximal responses (Emax) relative to reference agonists

    • Kinetic parameters: Analyze association/dissociation rates which may vary between species

    • Biased signaling profiles: Assess if ligands show different signaling preferences across species

  • Molecular basis interpretation:

    • Correlate binding differences with sequence divergence in binding pocket residues

    • Consider differences in allosteric modulation sites

    • Analyze potential differences in receptor expression levels and G protein coupling efficiency

  • Applications for bovine-specific tool development:

    • Design selective compounds exploiting unique residues in bovine NPY1R

    • Optimize dosing regimens based on species-specific pharmacokinetics

    • Develop positive controls specific for bovine receptor validation

Human NPY1R studies have shown that NPY binds with biphasic affinity (KD,1= 4.0 nM and KD,2= 126 nM) , and positions 2.68, 6.59, 2.64, 6.58, and 7.31 are critical for ligand binding . Species-specific differences in these positions may explain pharmacological variations.

What considerations are important when analyzing NPY1R-mediated signaling in the context of bovine energy metabolism research?

When analyzing NPY1R signaling in bovine energy metabolism studies:

  • Experimental design considerations:

    • Appropriate controls: Include both positive controls (known NPY1R activators) and negative controls (receptor antagonists, tissues lacking NPY1R)

    • Tissue specificity: Compare central (hypothalamus) vs. peripheral (adipose, liver, pancreas) NPY1R signaling

    • Nutritional state: Compare signaling in fed vs. fasted states

    • Breed variations: Account for genetic differences between dairy cattle breeds

  • Key signaling pathways to analyze:

    • cAMP inhibition: Primary Gi/o-coupled pathway of NPY1R

    • MAPK activation: Important for metabolic gene regulation

    • Calcium signaling: May influence secretory processes

    • Gene expression changes: Focus on metabolic enzymes and transporters

  • Data integration approaches:

    • Correlate receptor expression with metabolic parameters

    • Analyze potential compensation by other NPY receptor subtypes

    • Consider interaction with other metabolic hormone systems (insulin, leptin)

  • Interpretation challenges:

    • Central vs. peripheral effects: NPY1R activation can have opposite effects in different tissues

    • Temporal dynamics: Acute vs. chronic receptor activation may produce different outcomes

    • Compensatory mechanisms: Other systems may mask NPY1R effects in long-term studies

Studies have shown that NPY1R in the CNS can produce anti-hypertensive effects, while peripheral NPY1R activation causes vasoconstriction . In metabolic studies, conditional inactivation of NPY1R in hippocampal neurons altered sensitivity to diet-induced obesity, with mutant mice showing increased vulnerability to metabolic challenges on high-fat diets .

How can I effectively analyze and interpret NPY1R-GALR2 heterodimer formation data in the context of bovine neurogenesis studies?

When analyzing NPY1R-GALR2 heterodimer formation in neurogenesis research:

  • Quantitative analysis of heterodimer detection:

    • PLA signal quantification: Count PLA-positive puncta per cell or per defined tissue area

    • Statistical comparison: Use appropriate statistical tests (ANOVA with post-hoc tests) to compare PLA signal density across experimental conditions

    • Colocalization analysis: Quantify Pearson's or Mander's coefficients for fluorescently labeled receptors

  • Functional correlation analysis:

    • Proliferation markers: Correlate heterodimer levels with PCNA-positive and DCX-positive cell counts

    • Pathway activation: Measure downstream signaling activation (e.g., ERK phosphorylation)

    • Behavioral correlates: Link molecular findings to cognitive function measurements

  • Interpretation frameworks:

    • Synergistic effects: Determine if effects exceed the sum of individual receptor activations

    • Antagonist sensitivity profile: Assess if heterodimer signaling shows unique pharmacological properties

    • Cell-type specificity: Analyze which neural cell populations show heterodimer formation

  • Validation approaches:

    • Multiple detection methods: Confirm findings using complementary techniques (PLA, BRET/FRET)

    • Functional validation: Verify that heterodimer-specific signaling correlates with biological outcomes

    • Control experiments: Include non-dimerizing receptors as negative controls

In rodent studies, combined administration of GALR2 agonist M1145 and NPY1R agonist significantly increased NPY1R-GALR2 colocalization as measured by PLA puncta density in the dentate gyrus. This correlated with increased PCNA-positive and DCX-positive cell counts, indicating enhanced neurogenesis. The GALR2 antagonist M871 blocked these effects, confirming specificity .

What statistical approaches are most appropriate for analyzing NPY1R genetic variation data in bovine populations?

When analyzing bovine NPY1R genetic variation data:

  • Variant identification and quality control:

    • Filtering criteria: Set appropriate thresholds for read depth, mapping quality, and variant quality

    • Population stratification: Account for breed structure and relatedness

    • Hardy-Weinberg equilibrium testing: Identify potential genotyping errors

  • Association analysis methods:

    • Single-variant tests: Linear or logistic regression for quantitative or binary traits

    • Haplotype-based analysis: Assess effects of multiple linked variants

    • Mixed models: Account for population structure and kinship

    • Bayesian approaches: Particularly useful for genomic prediction

  • Multiple testing correction approaches:

    • Bonferroni correction: Conservative approach for strong control of family-wise error rate

    • False Discovery Rate (FDR): Less stringent but controls proportion of false positives

    • Permutation testing: Empirical p-value generation for complex data structures

  • Functional impact prediction:

    • Variant annotation tools: Predict effects on protein structure and function

    • Evolutionary conservation scores: Assess selective pressure on variant positions

    • Regulatory potential: Evaluate impact on transcription factor binding or miRNA targeting

  • Integrative analysis:

    • eQTL analysis: Link variants to expression differences

    • Pathway enrichment: Place findings in biological context

    • Cross-species comparison: Compare with human studies of NPY1R variants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.