Recombinant Bovine Neuropeptides B/W receptor type 1 (NPBWR1)

Shipped with Ice Packs
In Stock

Description

Overview

Neuropeptides B/W receptor type 1 (NPBWR1) is a class A GPCR that binds neuropeptide B (NPB) and neuropeptide W (NPW). The recombinant bovine variant is produced in E. coli as a full-length protein (1-331 amino acids) fused with an N-terminal His tag for purification . This receptor is structurally conserved across mammals, with seven transmembrane domains and a DRY motif critical for G-protein coupling .

Key Features:

  • Expression System: E. coli .

  • Post-Translational Modifications: None (prokaryotic expression lacks mammalian glycosylation) .

  • Purity: >90% by SDS-PAGE .

Functional Insights

NPBWR1 is implicated in:

  • Energy Homeostasis: Male rodents lacking NPBWR1 exhibit hyperphagia and obesity, suggesting its role in appetite suppression .

  • Pain Modulation: Overexpressed in Schwann cells during neuropathic pain, where it may inhibit inflammatory responses .

  • Emotional Regulation: A single nucleotide polymorphism (SNP rs33977775, Y135F) in humans alters receptor function, reducing cAMP inhibition and affecting emotional valence in social contexts .

Signal Transduction:

  • Couples with Gi/o proteins, inhibiting cAMP production via adenylate cyclase .

  • Activates ERK pathways through βγ subunits .

Applications in Research

Recombinant bovine NPBWR1 is used for:

  1. Ligand Binding Assays: Screening NPB/NPW analogs and synthetic modulators .

  2. Structural Studies: Mapping transmembrane domains and DRY motif interactions .

  3. Disease Models:

    • Obesity (via appetite regulation pathways) .

    • Neuropathic pain (Schwann cell interactions) .

    • Behavioral studies (SNP-linked emotional responses) .

Key Studies:

  1. SNP rs33977775 (Y135F):

    • Effect: Reduces cAMP inhibition by 40–60% compared to wild-type .

    • Behavioral Impact: Humans with the 404T allele perceive facial expressions more positively and exhibit reduced submission to aggressive stimuli .

  2. NPBWR1 in Pain Pathways:

    • Schwann cell overexpression correlates with reduced inflammatory pain in rodents .

  3. Therapeutic Potential:

    • Small-molecule agonists of NPBWR1 show promise for treating obesity and anxiety .

Technical Considerations

  • Reconstitution: Requires sterile water and glycerol (5–50%) for solubility .

  • Activity Validation: Functional assays (cAMP inhibition) confirm batch consistency .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type will be defined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
NPBWR1; GPR7; Neuropeptides B/W receptor type 1; G-protein coupled receptor 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MHNASYWGPERANTSCPAPAPTLGCPNASGPAPPLPPPLAVAVPVVYAVICAVGLAGNSA VLFVLLRAPRRKTVTNLFILNLAVADELFTLVPPVNIADFLLRRWPFGELLCKLVVAVDQ YNTFSSLYFLTVMSADRYLVVLATAESRRVAGRTYGAARAVSLAVWGVATLVVLPFAVFA RLDEEQGRRQCVLVFPQPEALWWRASRLYTLVLGFAIPVSTICVLYTSLLCRLRAIRLDS HAKALDRAKKRVTVLVVAILAVCLLVWTPYHLSTVVALTTDLPQTPLVIAVSYFITSLSY ANSCLNPFLYAFLDDSFRRSLRQLLACRTTS
Uniprot No.

Target Background

Function
Recombinant Bovine Neuropeptides B/W receptor type 1 (NPBWR1) interacts specifically with a variety of opioid ligands. It serves as a receptor for neuropeptides B and W, potentially playing a role in neuroendocrine system regulation, food intake, and the organization of other signals.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bovine NPBWR1 and how does it compare to human NPBWR1?

Recombinant Bovine NPBWR1 is a laboratory-produced version of the naturally occurring Neuropeptides B/W receptor type 1 found in bovine species. This G protein-coupled receptor contains seven transmembrane domains and shares significant structural homology with human NPBWR1 . Human NPBWR1 was previously known as orphan receptor GPR7 before its endogenous ligands were identified .

The bovine receptor, like its human counterpart, belongs to a receptor family that includes somatostatin and opioid receptors, and couples primarily to Gi-class G proteins to modulate intracellular signaling cascades . When comparing sequence conservation, bovine NPBWR1 maintains the critical binding domains necessary for interaction with Neuropeptide B (NPB) and Neuropeptide W (NPW), which serve as its endogenous ligands.

What expression systems yield optimal functional Recombinant Bovine NPBWR1?

For functional expression of Recombinant Bovine NPBWR1, mammalian expression systems typically provide superior results compared to bacterial systems due to the requirement for proper post-translational modifications and membrane integration. HEK293 and CHO cell lines have demonstrated particularly effective expression of functional NPBWR1.

The optimization protocol typically includes:

  • Gene sequence optimization for the host expression system

  • Incorporation of affinity tags (e.g., His-tag, FLAG-tag) for purification

  • Use of inducible promoters to control expression timing

  • Addition of signal peptides to ensure proper membrane localization

Expression in insect cells using baculovirus systems offers an alternative that can yield higher protein quantities while maintaining proper folding and post-translational modifications essential for ligand binding studies.

How can researchers verify the functional integrity of Recombinant Bovine NPBWR1?

Functional verification of Recombinant Bovine NPBWR1 requires demonstrating its ability to bind known ligands and initiate appropriate signaling cascades. Multiple complementary approaches provide robust validation:

  • Ligand binding assays: Using radiolabeled or fluorescently tagged NPB and NPW to determine binding affinity constants

  • G-protein coupling assays: Measuring inhibition of cAMP production, as NPBWR1 couples to Gi proteins

  • Calcium mobilization assays: Detecting changes in intracellular calcium levels following receptor activation

  • Receptor internalization studies: Monitoring receptor trafficking following ligand binding

  • Electrophysiological recordings: Measuring changes in membrane potential in response to ligand application

Recent research demonstrates that functional NPBWR1 exhibits specific activity patterns in response to its ligands, particularly in neurons of the central amygdala that respond to social novelty .

How can Recombinant Bovine NPBWR1 be utilized to study neuropsychiatric disorders?

Recombinant Bovine NPBWR1 serves as a valuable model for studying neuropsychiatric conditions due to the receptor's involvement in stress responses, social behavior, and mood regulation . Recent studies have identified NPBWR1 as a potential target for rapid-acting antidepressants .

Methodology for neuropsychiatric research applications includes:

  • Receptor binding screens: Identifying novel synthetic ligands that modulate NPBWR1 activity

  • Signaling pathway analysis: Determining downstream effects on BDNF and other neuroplasticity markers

  • Comparative pharmacology: Testing compounds like CYM50769, a synthetic antagonist of NPBWR1 that has demonstrated rapid antidepressant effects in rodent models

  • Structure-function relationship studies: Examining how receptor polymorphisms affect ligand binding and signaling

Research has shown increased NPBWR1 levels in the nucleus accumbens of chronically stressed mice and in postmortem samples from patients diagnosed with depression, suggesting its potential as a biomarker and therapeutic target .

What role does NPBWR1 play in social behavior research models?

NPBWR1-expressing neurons in the central amygdala are specifically activated during encounters with unfamiliar conspecifics but not with familiar ones . This makes Recombinant Bovine NPBWR1 particularly valuable for studying the neurobiological basis of social novelty seeking and social interaction.

Research applications include:

  • Optogenetic manipulation: Studies where selective activation of NPBWR1-expressing neurons has alleviated social deficits induced by chronic social defeat stress

  • Genetic modification studies: Investigating how overexpression or knockdown of NPBWR1 affects social preference behaviors

  • Polymorphism impact assessment: Examining how genetic variants (like the human NPBWR1 404A>T polymorphism) affect receptor function and subsequent social behavior

Research has demonstrated that CeA NPBWR1 neurons are essential for maintaining physical interactions with novel conspecifics, highlighting their importance in social novelty exploration .

How can structural studies of Recombinant Bovine NPBWR1 inform drug development?

Structural characterization of Recombinant Bovine NPBWR1 provides crucial insights for rational drug design targeting neuropsychiatric disorders. Techniques employed include:

  • X-ray crystallography: Determining high-resolution receptor structure, particularly focusing on ligand binding pockets

  • Cryo-electron microscopy: Visualizing receptor-ligand complexes in near-native conditions

  • Molecular dynamics simulations: Predicting conformational changes induced by ligand binding

  • Site-directed mutagenesis: Identifying critical residues for ligand interaction and signaling

TechniqueResolution CapabilitySample RequirementsKey Advantages
X-ray Crystallography1.5-3.0 ÅHighly purified, crystallizable proteinAtomic-level resolution of binding pockets
Cryo-EM2.5-4.0 ÅPurified protein in detergent micelles or nanodiscsVisualization of flexible regions
NMR SpectroscopyVariable resolutionIsotopically labeled proteinDynamic information about protein movement
HDX-MSPeptide-levelLess stringent purity requirementsConformational change information

The development of CYM50769, which shows promise as a fast-acting antidepressant, demonstrates the translational potential of structural insights into NPBWR1 function .

What are the optimal methods for studying NPBWR1 signaling pathways?

Understanding NPBWR1 signaling cascades requires specialized experimental approaches due to its coupling with inhibitory G proteins. Effective methodologies include:

  • BRET/FRET assays: For real-time monitoring of receptor-G protein coupling

  • Phosphoproteomic analyses: To identify downstream signaling events following receptor activation

  • Transcriptomic profiling: RNA sequencing reveals genes regulated by NPBWR1 activation

  • Electrophysiological recordings: Measuring neuronal activity changes in response to receptor modulation

Research has shown that NPBWR1 signaling affects BDNF expression, which is highly associated with depression and antidepressant response . Interestingly, RNA sequencing of tissue with overexpressed NPBWR1 revealed only 7 altered genes, suggesting highly specific downstream effects rather than broad transcriptional changes .

How can researchers effectively study NPBWR1 polymorphisms using recombinant systems?

NPBWR1 polymorphisms significantly impact receptor function and associated behaviors. For example, the human NPBWR1 gene single nucleotide polymorphism (SNP) 404A>T alters social behavior patterns . Methodological approaches include:

  • Site-directed mutagenesis: Creating recombinant NPBWR1 variants that mirror naturally occurring polymorphisms

  • Stable cell line development: Establishing cells expressing different NPBWR1 variants for comparative studies

  • Functional assays: Comparing signaling capacity, ligand binding affinity, and receptor trafficking between variants

  • In vivo models: Viral-mediated gene transfer to express polymorphic variants in animal models

What techniques enable high-throughput screening for NPBWR1 modulators?

Developing effective high-throughput screening (HTS) assays for NPBWR1 modulators requires specialized approaches due to the receptor's coupling to inhibitory G proteins. Recommended methodologies include:

  • GPCR internalization assays: Using fluorescently tagged NPBWR1 to monitor receptor trafficking

  • Impedance-based cellular assays: Real-time monitoring of whole-cell responses to receptor activation

  • Reporter gene assays: Utilizing cAMP-responsive elements linked to luciferase

  • Label-free technologies: Surface plasmon resonance for direct binding measurements

Assay TypeThroughputDetection MethodPrimary Application
Calcium FluxHighFluorescent dyeAgonist screening
cAMP InhibitionMediumHTRF/TR-FRETFunctional characterization
β-Arrestin RecruitmentHighBRETBiased signaling detection
Thermal ShiftMediumFluorescenceLigand binding validation
Competitive BindingMedium-HighRadioligand displacementBinding affinity determination

The development of the synthetic antagonist CYM50769, which demonstrated rapid antidepressant effects, exemplifies the potential of targeted screening approaches for identifying NPBWR1 modulators with therapeutic potential .

How might NPBWR1 research advance understanding of stress-related disorders?

NPBWR1 research shows significant promise for advancing our understanding of stress-related pathologies, particularly given recent findings that NPBWR1 levels increase in the nucleus accumbens following chronic stress . Future research directions include:

  • Circuit-specific manipulations: Investigating how NPBWR1-expressing neurons in different brain regions contribute to stress resilience

  • Longitudinal studies: Tracking NPBWR1 expression changes during stress exposure and recovery

  • Translational biomarker development: Evaluating whether peripheral NPBWR1 measurements could serve as accessible biomarkers

  • Combinatorial therapeutic approaches: Testing NPBWR1 modulators in conjunction with established treatments

The finding that CYM50769 produces rapid antidepressant effects that last up to 7 days after a single administration represents a particularly promising avenue for future investigation . This prolonged effect suggests potential advantages over current rapid-acting antidepressants that may require more frequent dosing.

What are the challenges in translating NPBWR1 research from animal models to human applications?

Translating NPBWR1 research findings from animal models to human applications faces several important challenges that researchers must address:

  • Species differences in expression patterns: While central amygdala expression is consistent across species, there may be regional variations in other brain areas

  • Polymorphism effects: The impact of genetic variations like the 404A>T polymorphism on therapeutic responses requires careful consideration

  • Sex-specific effects: Sex differences have been observed in NPBWR1 knockout models, with male rats showing hyperphagia and obesity while females were unaffected

  • Target selectivity: Developing compounds that selectively target NPBWR1 without affecting related receptors

Understanding these translational challenges is essential for developing effective NPBWR1-targeted therapeutics for conditions including depression, social anxiety disorders, and stress-related conditions.

How can advanced imaging techniques enhance NPBWR1 research?

Advanced imaging technologies offer powerful approaches for studying NPBWR1 function in living systems. Key methodologies include:

  • In vivo calcium imaging: Monitoring activity of NPBWR1-expressing neurons during social interactions and stress responses

  • PET imaging with selective radiotracers: Visualizing NPBWR1 distribution and occupancy in the living brain

  • Expansion microscopy: Analyzing subcellular localization of NPBWR1 in specific neuronal compartments

  • Multiphoton imaging: Longitudinal monitoring of NPBWR1-expressing neurons in behaving animals

Recent research utilizing calcium imaging demonstrated that CeA NPBWR1 neurons are specifically activated during encounters with unfamiliar mice but not with familiar ones, highlighting their role in processing social novelty . This selective activation pattern suggests these neurons help encode the distinction between novel and familiar social stimuli.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.