Recombinant Bovine Neuropeptides B/W receptor type 2 (NPBWR2)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Ligand Interactions

NPBWR2 binds neuropeptides B (NPB) and W (NPW), with distinct affinities:

  • Potency Rank Order: NPW23 > NPW30 > NPB .

  • Signaling Pathway: Couples to Gi-proteins, inhibiting cAMP production and activating GIRK channels .

Comparison with NPBWR1

FeatureNPBWR2NPBWR1
Ligand PreferenceHigher affinity for NPW23 vs. NPBHigher affinity for NPB vs. NPW isoforms
Evolutionary PresenceAbsent in rodents; conserved in primates, rabbits, and chickensWidely conserved across mammals
Primary LocalizationBrain (parietal cortex, caudate nucleus), peripheral tissues (pituitary, adrenal gland)Brain (hippocampus, amygdala), peripheral tissues (aorta, adipocytes)

Energy Homeostasis

NPBWR2 knockout studies in mice reveal roles in:

  • Feeding Behavior: NPBWR2-deficient mice exhibit hyperphagia and late-onset obesity .

  • Sympathetic Regulation: NPW23/NPBWR2 signaling increases heat production and sympathetic outflow .

Pain Modulation

NPBWR2 agonists show promise as analgesics for chronic inflammatory pain. Npb knockout mice display hypersensitivity to inflammatory pain, suggesting a protective role for NPB/NPW signaling .

Stress Response

In chickens, NPBWR2 is abundant in pituitary corticotrophs, where NPW suppresses adrenocorticotropic hormone (ACTH) secretion via cAMP inhibition. This highlights its role in regulating the hypothalamic-pituitary-adrenal (HPA) axis .

Production and Handling

Recombinant NPBWR2 is optimized for biochemical assays:

  • Purity Assurance: >90% purity ensures minimal contaminants in receptor-ligand binding studies.

  • Storage: Lyophilized protein requires storage at -20°C/-80°C, with aliquoting to avoid freeze-thaw cycles .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have any specific format requirements, please indicate them in your order notes. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
NPBWR2; GPR8; Neuropeptides B/W receptor type 2; G-protein coupled receptor 8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-336
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MMEATGLEGLESTSSPCPGSTGTGLSWDNGTRHNATFPEPLPALYVLLPVVYSVICAVGL VGNAAVICVILRAPKMKTVTHVFILNLAIADGLFTLVLPTNIAEHLLQRWPFGEVLCKLV LAIDHCNIFSSVYFLAAMSIDRYLVVLATARSRRMPRRTVHRAKVASLCVWLGVTVAVLP FLTFAGVYNNELQVTSCGLSFPRPERAWFQASRIYTLVLGFVVPMCTLCVLYADLLRRLR ALRLHSGAKALGKAKRKVSLLVLAVLAVGLLCWTPFHLASIVALTTDLPQTPLVIIVSYV VTSLSYTSSCLNPFLYAFLDHSFRKSLRTACRCQGA
Uniprot No.

Target Background

Function
This receptor interacts specifically with a number of opioid ligands. It acts as the receptor for neuropeptides B and W, which are believed to play a role in neuroendocrine system regulation, food intake, and the organization of other signals.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bovine Neuropeptides B/W Receptor Type 2 (NPBWR2)?

Recombinant Bovine Neuropeptides B/W receptor type 2 (NPBWR2) is an artificially expressed form of the bovine NPBWR2 protein. NPBWR2 is a G protein-coupled receptor (GPCR) that was originally identified as an orphan receptor called GPR8. The receptor is structurally similar to opioid and somatostatin receptors and functions as an integral membrane protein . The recombinant form is produced through various expression systems including E. coli, yeast, baculovirus, or mammalian cell systems to generate functional protein for research applications .

The receptor binds to endogenous peptide ligands known as neuropeptide B (NPB) and neuropeptide W (NPW), which were identified in the early 2000s . Through its G protein-coupled signaling, NPBWR2 plays roles in several physiological processes including energy homeostasis, pain regulation, and potentially emotional responses. In its recombinant form, the bovine NPBWR2 protein can be expressed as either full-length receptor or as partial protein fragments depending on the specific research requirements and expression system employed .

What are the endogenous ligands for NPBWR2 and how were they discovered?

NPBWR2 has two primary endogenous peptide ligands: neuropeptide B (NPB) and neuropeptide W (NPW). These ligands were identified between 2002 and 2003 by multiple research groups using "reverse pharmacology" approaches combined with bioinformatics techniques . The discovery process involved expressing the receptors (previously known as orphan receptors GPR7 and GPR8) in cell lines such as Chinese Hamster Ovary (CHO) cells and measuring decreases in forskolin-induced cAMP production as an indicator of receptor activation. By screening bovine hypothalamic extract fractions, researchers purified and identified these active peptides .

Neuropeptide W exists in two forms with different peptide lengths: NPW23 (23 amino acids) and NPW30 (30 amino acids). NPW23 results from proteolytic processing at a pair of arginine residues in positions 24 and 25 of NPW30 . Neuropeptide B has a unique characteristic—bromination of the first tryptophan residue (C-6-bromination). This represents the first evidence of protein bromination in mammals, though the biological significance of this modification remains unclear as des-bromo-NPB shows similar potency to brominated NPB in functional assays .

Both NPB and NPW bind to NPBWR2 with varying affinities. For NPBWR2, the potency rank order is NPW23 > NPW30 > NPB, indicating that NPW23 has the highest affinity for this receptor . Structure-activity studies have shown that the N-terminal region of these peptides is critical for receptor binding, as deletion of the first tryptophan residue significantly decreases their activity .

What expression systems are used to produce Recombinant Bovine NPBWR2 and how do they compare?

Recombinant Bovine NPBWR2 can be produced using several expression systems, each with distinct advantages for different research applications. Based on the available commercial information, the following expression systems are commonly used:

Expression SystemAdvantagesLimitationsApplications
E. coliHigh yield, cost-effective, rapid expressionMay lack post-translational modifications, potential improper folding of membrane proteinsStructural studies, antibody production, protein interaction assays
YeastEukaryotic post-translational modifications, proper protein foldingMore complex than bacterial systems, some modifications may differ from mammalianFunctional studies requiring basic glycosylation
Baculovirus/Insect CellsAdvanced post-translational modifications, proper folding of complex proteinsHigher cost, longer production timeReceptor binding assays, conformational studies
Mammalian Cell SystemsNative-like post-translational modifications, optimal for functional membrane proteinsMost expensive, lowest yield, technical complexityCell signaling studies, drug screening
In Vivo Biotinylation in E.coliSite-specific biotinylation for detection and immobilizationSpecialized technique, may affect protein functionProtein capture assays, protein-protein interaction studies

The selection of an appropriate expression system depends on the specific research requirements. For the full-length Recombinant Bovine NPBWR2, E. coli expression systems are commonly used, while partial proteins can be produced in various systems including yeast, E. coli, baculovirus, mammalian cells, or with in vivo biotinylation in E. coli . When designing experiments, researchers should consider how the expression system might influence receptor functionality, particularly for G protein-coupled receptors like NPBWR2 where proper folding and membrane insertion are critical for ligand binding and signaling.

How can the functionality of Recombinant Bovine NPBWR2 be assessed in vitro?

Assessing the functionality of Recombinant Bovine NPBWR2 in vitro requires multiple approaches to evaluate its binding capacity, signaling properties, and structural integrity. Since NPBWR2 is a G protein-coupled receptor that couples to Gi-class G-proteins, several methodological approaches can be employed:

  • cAMP Inhibition Assays: As NPBWR2 couples to Gi proteins, its activation inhibits adenylyl cyclase, reducing cAMP production. Forskolin-stimulated cells expressing recombinant NPBWR2 should show decreased cAMP levels upon addition of NPB or NPW ligands .

  • Radioligand Binding Assays: Using radiolabeled NPW or NPB can determine binding affinities (Kd) and receptor densities (Bmax). Competition binding with unlabeled ligands can establish rank order potencies of different ligands, which should follow the pattern NPW23 > NPW30 > NPB for NPBWR2 .

  • BRET/FRET-Based Assays: Bioluminescence/Fluorescence Resonance Energy Transfer assays can detect conformational changes upon ligand binding. For example, using nanoluciferase fused to the N-terminus of the receptor as energy donor and fluorophore-tagged peptide ligand as acceptor provides a homogeneous, wash-free assay system for measuring ligand affinities .

  • G Protein Activation Assays: [³⁵S]GTPγS binding assays can directly measure G protein activation following receptor stimulation.

  • ERK Phosphorylation Assays: Since NPB and NPW stimulate Erk p42/p44 activity via Gi protein beta/gamma subunits, western blotting for phosphorylated ERK can serve as a downstream readout of receptor activation .

  • GIRK Channel Activation: Electrophysiological recordings in cells co-expressing NPBWR2 and GIRK (Kir3) channels can detect the inhibitory properties of receptor activation through G protein-coupled inwardly rectifying potassium channels .

When validating recombinant bovine NPBWR2 functionality, it's essential to include appropriate positive and negative controls and to confirm that the pharmacological profile matches the expected characteristics of NPBWR2, particularly the distinctive rank order potency of its ligands.

What is the significance of NPBWR2 absence in rodent genomes?

The absence of NPBWR2 (formerly GPR8) in rodent genomes represents a significant evolutionary divergence with important implications for translational research and comparative physiology. While NPBWR2 has been discovered in several mammalian species including humans, monkeys, lemurs, bats, shrews, rabbits, and bovines, it is notably absent in mice and rats . This absence has several important research implications:

  • Evolutionary Perspective: The presence of NPBWR2 in some mammals but not in rodents suggests this receptor resulted from a relatively recent gene duplication event. NPBWR1 and NPBWR2 share approximately 64% sequence homology, supporting the duplication hypothesis .

  • Animal Model Limitations: The absence of NPBWR2 in rodents creates a significant challenge for researchers studying this receptor system, as mice and rats—the most common laboratory animals—cannot be used for NPBWR2-specific research without genetic modification.

  • Functional Compensation: Research questions arise regarding whether NPBWR1 in rodents compensates for NPBWR2 functions or if other receptors have evolved to fulfill its roles. Understanding these compensatory mechanisms could provide insights into receptor redundancy and specialization.

  • Translational Research Challenges: Findings regarding NPBWR2 function in humans, bovines, or other species cannot be directly validated in conventional rodent models, necessitating alternative approaches like humanized transgenic mice or use of larger animal models.

  • Species-Specific Signaling: The conservation of NPBWR2 in bovines and humans but not in rodents suggests potentially important species-specific differences in neuropeptide signaling that may be relevant to understanding comparative physiology and pharmacology.

This phylogenetic pattern indicates the importance of conducting comparative studies between species that possess NPBWR2 (like bovines and humans) and those that lack it (like rodents) to understand the unique physiological roles of this receptor .

What signaling pathways are activated by NPBWR2 and how do they differ from NPBWR1?

NPBWR2 activation initiates complex intracellular signaling cascades with both overlapping and distinct features compared to NPBWR1. Understanding these pathways is crucial for interpreting the physiological roles of this receptor system.

Primary G Protein Coupling:
Both NPBWR1 and NPBWR2 predominantly couple to the Gi/Go class of G proteins, consistent with their structural similarities to somatostatin and opioid receptors . This coupling leads to several downstream effects:

  • Inhibition of Adenylyl Cyclase: Activation of Gi proteins inhibits adenylyl cyclase, resulting in decreased intracellular cAMP levels. This represents the primary signaling mechanism used in the original deorphanization assays for these receptors .

  • Activation of GIRK Channels: The inhibitory properties of NPBWR2 signaling on neurons are mediated through activation of G protein-coupled inwardly rectifying potassium (GIRK/Kir3) channels, which leads to hyperpolarization and reduced neuronal excitability .

  • ERK Pathway Activation: NPB and NPW stimulate Erk p42/p44 activity in cellular models, likely mediated by beta/gamma subunits released from Gi proteins . This has been demonstrated in human adrenocortical carcinoma-derived NCI-H295 cells and represents a key mitogen-activated protein kinase pathway.

Differences from NPBWR1:
While both receptors share these primary signaling mechanisms, several differences in signaling efficiency, cellular distribution, and downstream effectors exist:

  • Ligand Potency Differences: The distinct rank order potency of ligands (NPW23 > NPW30 > NPB for NPBWR2 versus a slight preference for NPB in NPBWR1) suggests different efficiencies in G protein coupling or receptor conformational changes upon ligand binding .

  • Tissue-Specific Signaling Partners: Human NPBWR2 is primarily expressed in the frontal cortex , while NPBWR1 shows more widespread expression in the hypothalamus, hippocampus, ventral tegmental area, and extended amygdala . These different cellular environments provide distinct sets of signaling partners that may result in tissue-specific signaling outcomes.

  • Potential Biased Signaling: Like many GPCRs, NPBWR2 may exhibit biased signaling, where different ligands preferentially activate certain downstream pathways over others. Given the different affinities of NPB and NPW isoforms, they might induce distinct conformational changes in the receptor that favor coupling to different effector systems.

For researchers investigating NPBWR2 signaling, it is important to consider these multifaceted pathways and their potential tissue-specific and ligand-specific variations. Comparing bovine NPBWR2 signaling with human NPBWR2 would also provide valuable insights into species-specific differences in receptor function.

What are the challenges in developing selective agonists or antagonists for NPBWR2?

Developing selective pharmacological tools for NPBWR2 presents significant challenges due to structural similarities with related receptors, complex ligand-receptor interactions, and limited structural information. These challenges and potential strategies to overcome them are critical considerations for researchers in this field.

Major Challenges:

  • Receptor Similarity: NPBWR2 shares 64% sequence homology with NPBWR1 and has structural similarities to opioid and somatostatin receptors . This high degree of similarity, particularly in the transmembrane domains where ligand binding often occurs, makes achieving selectivity difficult.

  • Peptide Ligand Complexity: The endogenous ligands NPB and NPW are relatively large peptides with complex structures. NPW23 comprises 23 amino acids, and developing small molecule mimetics that retain selectivity while gaining drug-like properties presents significant medicinal chemistry challenges.

  • Species Differences: The absence of NPBWR2 in rodents complicates preclinical testing, as traditional rodent models cannot be used to evaluate selectivity against the closely related NPBWR1 in a physiological context without genetic modification.

  • Limited Structural Information: Unlike some well-studied GPCRs, high-resolution crystal or cryo-EM structures of NPBWR2 in complex with ligands are not available, limiting structure-based drug design approaches.

  • Post-Translational Modifications: The unique bromination of NPB's N-terminal tryptophan represents a post-translational modification that may be difficult to replicate in synthetic compounds.

Strategic Approaches:

  • Structure-Activity Relationship Studies: Systematic modification of NPW23, which shows highest affinity for NPBWR2, could identify the minimal pharmacophore required for binding and activation. Particularly, focusing on the N-terminal region which is critical for receptor recognition may yield productive leads.

  • Computational Modeling: Homology modeling based on related GPCRs with known structures, combined with molecular dynamics simulations of ligand binding, could provide insights into the structural determinants of selectivity.

  • Fragment-Based Drug Discovery: Identifying small molecules that bind to different regions of the NPBWR2 binding pocket and linking them together could generate novel scaffolds with improved selectivity.

  • Allosteric Modulators: Targeting allosteric sites unique to NPBWR2 rather than the orthosteric binding site could potentially achieve greater selectivity, as allosteric sites often show more sequence divergence between related receptors.

Progress has been made with the recent development of a synthetic low molecular weight antagonist for NPBWR1 , and similar approaches could be applied to NPBWR2. Researchers should consider cross-screening against related receptors to fully characterize the selectivity profile of any new compounds targeting NPBWR2.

How can protein engineering enhance the utility of Recombinant Bovine NPBWR2 for research applications?

Protein engineering offers powerful approaches to enhance Recombinant Bovine NPBWR2's utility for various research applications, from improving expression and stability to enabling advanced detection methods and structural studies. These engineered modifications can overcome inherent limitations of this membrane protein while preserving its native functions.

Strategies for Enhanced Expression and Stability:

  • Thermostabilizing Mutations: Introducing point mutations that enhance thermostability can improve expression yields and maintain receptor in active conformations. Alanine scanning or computational prediction methods can identify residues whose mutation increases stability without affecting ligand binding properties.

  • N-Terminal Modifications: Addition of well-folding domains or epitope tags to the N-terminus can enhance solubility and expression levels. The search results show examples of N-terminal modifications with HA signal peptides and Flag epitope tags that had minimal effect on receptor function .

  • C-Terminal Engineering: Modification of the C-terminus with tags like the twin-strep-tag used in structural studies can facilitate purification while maintaining receptor functionality. The C-terminal region can often be truncated or modified with minimal impact on signaling, as demonstrated in NPY receptor studies.

Tools for Advanced Detection and Analysis:

  • BRET/FRET-Compatible Fusions: Fusion of bioluminescent or fluorescent proteins enables real-time monitoring of receptor activation, internalization, and protein-protein interactions. Nanoluciferase fusions at the N-terminus have been successfully used with other GPCRs to create homogeneous, wash-free assay systems for measuring ligand affinities .

  • Site-Specific Labeling Sites: Introduction of unique reactive groups allows for site-specific attachment of fluorophores, affinity tags, or crosslinkers at defined positions.

  • Conformational Biosensors: Insertion of environmentally sensitive fluorophores or FRET pairs at strategic positions can create sensors that report on ligand-induced conformational changes with high sensitivity.

Approaches for Structural Studies:

  • Fusion with Crystallization Chaperones: Insertion of well-crystallizing proteins like T4 lysozyme or BRIL into intracellular loops can facilitate crystal formation for X-ray crystallography without disrupting ligand binding.

  • Nanobody-Stabilized Complexes: Co-expression with or addition of conformation-specific nanobodies can stabilize particular receptor states, enhancing the probability of successful structural determination.

Application-Specific Modifications:

  • Biotinylated Receptors: In vivo biotinylation, as mentioned in the commercial availability of such products , enables strong, specific immobilization for binding assays, pull-down experiments, or biosensor applications.

When implementing these engineering strategies, it's crucial to validate that the modified receptor maintains its native pharmacological profile by comparing ligand binding affinities and signaling responses to unmodified controls. The rank order potency of NPW23 > NPW30 > NPB should be preserved in any engineered variant of NPBWR2 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.