Recombinant Bovine Nuclear envelope phosphatase-regulatory subunit 1 (CNEP1R1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1)

Recombinant Bovine Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1) is a protein that plays a crucial role in regulating the activity of nuclear envelope phosphatases. While specific information on the recombinant bovine version is limited, insights from human and other species can provide valuable context. In humans, CNEP1R1 is known as NEP1R1 and functions as a regulatory subunit for C-terminal Domain Nuclear Envelope Phosphatase 1 (CTDNEP1), enhancing its phosphatase activity and stability .

Function and Mechanism

CNEP1R1, similar to its human counterpart NEP1R1, likely acts as an activating regulatory subunit. It binds to and enhances the phosphatase activity of its associated enzyme, which is crucial for maintaining endoplasmic reticulum (ER) membrane morphology. This interaction is essential for regulating ER expansion and lipid synthesis .

Key Functions:

  • Enhances Phosphatase Activity: CNEP1R1 increases the catalytic activity of its associated phosphatase.

  • Stabilizes the Phosphatase: It helps prevent aggregation and degradation of the phosphatase, ensuring its stability and function.

  • Regulates ER Morphology: By modulating phosphatase activity, CNEP1R1 contributes to maintaining the structure of the ER.

Research Findings

Research on the human NEP1R1 has provided significant insights into its role and mechanism. While direct studies on recombinant bovine CNEP1R1 are not available, these findings can be extrapolated to understand its potential functions:

Human NEP1R1 Studies:

  • CTDNEP1-NEP1R1 Complex: This complex restricts ER expansion by dephosphorylating lipin, a key enzyme in lipid synthesis .

  • Structural Insights: High-resolution crystal structures have revealed how NEP1R1 binds and activates CTDNEP1, facilitating substrate recognition .

Data Tables

FeatureDescription
FunctionEnhances phosphatase activity and stability.
BindingDirectly binds to CTDNEP1, stabilizing and activating it.
Role in EREssential for maintaining ER morphology by regulating lipin dephosphorylation.
Structural InsightsEngages CTDNEP1 at a site distant from the active site, facilitating allosteric activation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CNEP1R1; TMEM188; Nuclear envelope phosphatase-regulatory subunit 1; Transmembrane protein 188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CNEP1R1
Target Protein Sequence
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ
Uniprot No.

Target Background

Function

CNEP1R1, forms an active complex with the serine/threonine protein phosphatase CTDNEP1. This complex dephosphorylates and potentially activates LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol, regulating fatty acid metabolism at multiple levels. CNEP1R1 may indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes, influencing nuclear membrane morphology and dynamics. It may also indirectly regulate lipid droplet production and triacylglycerol levels.

Database Links
Protein Families
CNEP1R1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm.

Q&A

What is CNEP1R1 and what is its primary cellular function?

CNEP1R1 (CTD Nuclear Envelope Phosphatase 1 Regulatory Subunit 1) functions as a transmembrane regulatory subunit that directly binds to and enhances the catalytic activity of CTDNEP1 (C-terminal Domain Nuclear Envelope Phosphatase 1) . This protein complex plays a critical role in regulating endoplasmic reticulum (ER) membrane biogenesis across species. CNEP1R1 acts as an activating regulatory subunit that not only binds CTDNEP1 but also significantly increases its phosphatase activity . The complex is evolutionarily conserved and has been established as a membrane protein phosphatase complex that restricts ER expansion, with knockdown of NEP1R1 generating identical phenotypes to the loss of CTDNEP1 in mammalian cells .

How is the structure of CNEP1R1 characterized across species?

CNEP1R1 is characterized as a transmembrane protein belonging to the Tmemb_18A family . Crystal structures of the CTDNEP1-NEP1R1 complex reveal that NEP1R1 engages CTDNEP1 at a site distant from the active site to stabilize and allosterically activate CTDNEP1 . While specific bovine CNEP1R1 structural data is limited, comparative analysis with human CNEP1R1 (also known by synonyms C16orf69, TMEM188, and TMP125) and CNEP1R1 in other mammals such as Pantholops hodgsonii reveals conserved regulatory mechanisms. In Pantholops hodgsonii, CNEP1R1 exists in multiple isoforms, including nuclear envelope phosphatase-regulatory subunit 1 isoforms X1 and X2 .

What experimental approaches are recommended for initial characterization of bovine CNEP1R1?

For initial characterization of bovine CNEP1R1, researchers should consider a multi-faceted approach:

  • Sequence Analysis: Begin with comparative genomic analysis against well-characterized CNEP1R1 sequences from human (Gene ID: 255919) and other mammals like Pantholops hodgsonii (Gene ID: 102327027) .

  • Expression Profiling: Utilize RT-PCR and Western blotting to confirm expression in bovine tissues, particularly focusing on endoplasmic reticulum-rich tissues.

  • Subcellular Localization: Employ immunofluorescence microscopy with ER markers to confirm the expected nuclear envelope/ER localization pattern.

  • Functional Assays: Develop cell-based assays to assess effects on ER morphology, as NEP1R1 depletion has been shown to result in ER expansion in human cells .
    These methodologies should be optimized for bovine cell models, and researchers should account for potential species-specific differences in protein function and localization.

What are the optimal methods for recombinant expression and purification of bovine CNEP1R1?

Based on established protocols for related proteins, the following methodological approaches are recommended for recombinant bovine CNEP1R1:

How can researchers effectively assess the interaction between bovine CNEP1R1 and CTDNEP1?

To characterize the interaction between bovine CNEP1R1 and CTDNEP1, researchers should employ multiple complementary approaches:

  • In Vitro Binding Assays:

    • Surface Plasmon Resonance (SPR) to determine binding kinetics and affinity constants

    • Isothermal Titration Calorimetry (ITC) to measure thermodynamic parameters

    • Pull-down assays with recombinant proteins to confirm direct interaction

  • Cellular Interaction Studies:

    • Co-immunoprecipitation from bovine tissue or cell extracts

    • Proximity ligation assays to visualize interactions in situ

    • FRET or BiFC assays in bovine cell lines to confirm proximity in living cells

  • Functional Reconstitution:

    • In vitro phosphatase activity assays with purified components

    • Structure-guided mutagenesis of predicted interface residues based on human complex structures
      Human CNEP1R1 has been shown to bind CTDNEP1 with micromolar affinity and significantly enhance its phosphatase activity . Researchers should design experiments to determine if these parameters are conserved in the bovine system or if species-specific differences exist.

What techniques are most effective for studying the cellular localization and trafficking of bovine CNEP1R1?

To study localization and trafficking of bovine CNEP1R1:

  • Immunocytochemistry and Confocal Microscopy:

    • Co-staining with organelle markers (calnexin for ER, lamin for nuclear envelope)

    • Super-resolution microscopy for detailed localization analysis

    • Live-cell imaging with fluorescently tagged CNEP1R1 to observe dynamic behavior

  • Biochemical Fractionation:

    • Differential centrifugation to separate cellular compartments

    • Density gradient fractionation for refined organelle separation

    • Western blotting of fractions with compartment-specific markers

  • Trafficking Analysis:

    • Photoactivatable or photoconvertible fusion proteins for pulse-chase analysis

    • RUSH (Retention Using Selective Hooks) system to synchronize protein trafficking

    • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility

  • Perturbation Approaches:

    • Brefeldin A treatment to disrupt ER-Golgi trafficking

    • Microtubule disrupting agents to assess cytoskeleton-dependent transport

    • Temperature blocks to arrest trafficking at specific stages
      Based on studies of human CNEP1R1, researchers should expect localization primarily to the nuclear envelope and ER, as human CNEP1R1 is a transmembrane protein that forms a complex with CTDNEP1 at these locations .

How does the phosphatase activity of the CNEP1R1-CTDNEP1 complex regulate ER membrane homeostasis in bovine cells?

The regulation of ER membrane homeostasis by the CNEP1R1-CTDNEP1 complex involves several interconnected molecular mechanisms:

  • Lipin Dephosphorylation: Human studies show that the CTDNEP1-NEP1R1 complex promotes lipin dephosphorylation, which directly impacts phospholipid synthesis . Researchers investigating the bovine system should examine:

    • Phosphorylation status of bovine lipin proteins in response to CNEP1R1 manipulation

    • Correlations between lipin phosphorylation state and phospholipid synthesis rates

    • Species-specific differences in lipin regulation pathways

  • ER Morphology Analysis:

    • Quantitative EM analysis of ER expansion following CNEP1R1 depletion

    • Live-cell imaging with ER markers to track dynamic changes

    • 3D reconstruction of ER networks to assess structural alterations

  • Lipid Metabolism Assessment:

    • Lipidomic analysis to identify changes in phospholipid composition

    • Radioisotope labeling to measure synthesis rates of specific lipid species

    • Integration of metabolomic data with transcriptomic responses

  • Signal Transduction Mapping:

    • Identification of downstream substrates using phosphoproteomic approaches

    • Kinase/phosphatase activity assays to establish regulatory networks

    • Temporal analysis of signaling events following stimulation or depletion
      Research in human cells has established that loss of NEP1R1 results in ER expansion identical to CTDNEP1 depletion phenotypes , suggesting conservation of this regulatory mechanism across mammals.

What structural determinants of bovine CNEP1R1 are critical for its interaction with and activation of CTDNEP1?

Based on high-resolution crystal structures of the human CTDNEP1-NEP1R1 complex , researchers investigating bovine CNEP1R1 should explore:

  • Structure-Guided Mutagenesis:

    • Target predicted interface residues based on human structures

    • Create alanine-scanning libraries across putative interaction surfaces

    • Engineer bovine-specific variants to test evolutionary conservation

  • Domain Analysis:

    • Express truncation constructs to identify minimal binding domains

    • Test chimeric proteins with domains from different species

    • Perform deletion analysis of transmembrane versus soluble regions

  • Allosteric Activation Mechanism:

    • Investigate conformational changes upon binding using hydrogen-deuterium exchange

    • Employ FRET-based sensors to detect structural rearrangements

    • Identify potential allosteric sites using computational modeling

  • Structure Determination:

    • Pursue crystallization of bovine CNEP1R1-CTDNEP1 complex

    • Consider cryo-EM for intact complex including transmembrane domains

    • Perform NMR studies on isolated domains if suitable
      Human studies have demonstrated that NEP1R1 engages CTDNEP1 at a site distant from the active site to stabilize and allosterically activate the phosphatase . Researchers should determine if these activation mechanisms are conserved in the bovine system.

How do post-translational modifications affect bovine CNEP1R1 function and complex formation?

To investigate the role of post-translational modifications (PTMs) in bovine CNEP1R1:

  • PTM Identification:

    • Perform mass spectrometry analysis to map PTM sites

    • Use phospho-specific antibodies to monitor phosphorylation states

    • Apply glycosylation-specific stains to assess glycosylation patterns

  • Functional Impact Assessment:

    • Generate PTM site mutants (phospho-mimetic and phospho-null)

    • Evaluate effects on protein stability, localization, and binding

    • Measure phosphatase activity changes in response to PTM alterations

  • Regulatory Enzyme Identification:

    • Conduct kinase/phosphatase inhibitor screens

    • Perform targeted siRNA knockdowns of candidate modifying enzymes

    • Use proximity labeling to identify physically associated modifiers

  • Dynamic Regulation:

    • Monitor PTM changes during cell cycle progression

    • Assess stress-induced PTM alterations

    • Investigate tissue-specific PTM patterns
      While specific information about bovine CNEP1R1 PTMs is limited, researchers should consider that transmembrane regulatory proteins often undergo phosphorylation, glycosylation, and ubiquitination as regulatory mechanisms.

How does bovine CNEP1R1 compare with its orthologs in other species in terms of structure and function?

Comparative analysis of CNEP1R1 across species reveals important evolutionary insights:

SpeciesGene IDProtein LengthKey FeaturesIsoforms
Homo sapiens (Human)255919 Varies by isoformTransmembrane protein, Tmemb_18A family Multiple splice variants
Pantholops hodgsonii (Chiru)102327027 126 aa (isoform X1) Nuclear envelope phosphatase-regulatory subunit 1 Isoforms X1, X2
Bos taurus (Bovine)PredictedPredicted to be similar to human/chiruPredicted transmembrane domainsPredicted multiple isoforms
For bovine CNEP1R1, researchers should:
  • Sequence Comparison:

    • Conduct phylogenetic analysis to establish evolutionary relationships

    • Identify conserved domains and species-specific variations

    • Map conservation patterns onto structural models

  • Functional Conservation Testing:

    • Perform cross-species complementation experiments

    • Evaluate interchangeability of domains between orthologs

    • Assess binding specificity with CTDNEP1 from different species

  • Expression Pattern Analysis:

    • Compare tissue distribution across species

    • Identify developmental regulation differences

    • Evaluate responses to physiological stimuli
      Human and related mammalian studies suggest CNEP1R1 function in regulating ER membrane biogenesis is evolutionarily conserved , making it likely that bovine CNEP1R1 shares core functional properties.

What specialized adaptations might bovine CNEP1R1 exhibit compared to human or other mammalian versions?

Based on evolutionary biology principles and known differences in metabolism between bovines and other mammals, researchers might investigate:

  • Tissue-Specific Adaptations:

    • Examine expression levels in ruminant-specific tissues

    • Investigate adaptations related to mammary gland function

    • Assess potential roles in adipose tissue regulation in bovines

  • Metabolic Specializations:

    • Explore connections to ruminant-specific lipid metabolism

    • Investigate potential roles in energy storage adaptations

    • Assess responses to metabolic challenges specific to bovines

  • Regulatory Differences:

    • Compare promoter regions and transcription factor binding sites

    • Assess differences in mRNA stability and translational control

    • Investigate species-specific interacting partners

  • Structural Adaptations:

    • Identify bovine-specific amino acid substitutions

    • Model potential impacts on protein stability or function

    • Assess differences in post-translational modification sites
      While direct evidence for bovine-specific adaptations of CNEP1R1 is limited, researchers should consider that differences in lipid metabolism between ruminants and non-ruminants might be reflected in adaptations of proteins regulating ER membrane biogenesis.

What are the implications of CNEP1R1 dysfunction in bovine disease models?

Researchers investigating bovine CNEP1R1 in disease contexts should consider:

  • Metabolic Disorders:

    • Based on the role of CNEP1R1-CTDNEP1 in lipid metabolism, investigate connections to:

      • Hepatic lipidosis in dairy cattle

      • Metabolic adaptations during transition periods

      • Fatty liver syndrome and related conditions

  • ER Stress-Related Pathologies:

    • Examine the role of CNEP1R1 in:

      • ER stress responses in high-producing dairy cows

      • Adaptations to nutritional challenges

      • Cellular responses to toxins affecting ER function

  • Developmental Disorders:

    • Investigate potential involvement in:

      • Embryonic development abnormalities

      • Organogenesis of lipid-processing tissues

      • Congenital disorders affecting ER-rich tissues
        Research should be guided by findings in human studies, where CTDNEP1 mutations correlate with medulloblastoma development , suggesting CNEP1R1-CTDNEP1 dysfunction may have significant disease implications.

How can advanced genomic techniques be applied to study bovine CNEP1R1 expression patterns across tissues and developmental stages?

Researchers can employ multiple genomic approaches to characterize bovine CNEP1R1:

  • RNA-Seq Analysis:

    • Perform differential expression analysis across tissues

    • Track expression changes throughout developmental stages

    • Identify co-expressed gene networks

  • Single-Cell Transcriptomics:

    • Map cell type-specific expression patterns

    • Identify cellular heterogeneity in CNEP1R1 expression

    • Track lineage-specific expression during differentiation

  • ATAC-Seq and ChIP-Seq:

    • Characterize chromatin accessibility at the CNEP1R1 locus

    • Identify transcription factor binding patterns

    • Map epigenetic modifications affecting expression

  • Spatial Transcriptomics:

    • Visualize tissue-specific expression patterns with spatial context

    • Identify regional variations within organs

    • Correlate with histological features
      These approaches should be integrated with proteomic data to develop a comprehensive understanding of bovine CNEP1R1 regulation across different physiological contexts.

What are the emerging techniques that could advance our understanding of bovine CNEP1R1 function?

Several cutting-edge approaches show promise for advancing bovine CNEP1R1 research:

  • CRISPR-Cas9 Genome Editing in Bovine Models:

    • Generate CNEP1R1 knockout or knockin bovine cell lines

    • Create reporter lines for live monitoring of CNEP1R1 activity

    • Introduce specific mutations to test functional hypotheses

  • Cryo-Electron Tomography:

    • Visualize native CNEP1R1-CTDNEP1 complexes in cellular membranes

    • Map 3D organization of complexes relative to ER structure

    • Determine structural changes under different physiological conditions

  • Integrative Multi-Omics:

    • Combine transcriptomics, proteomics, lipidomics, and metabolomics

    • Develop computational models of CNEP1R1-regulated networks

    • Identify system-level responses to CNEP1R1 manipulation

  • Organoid and 3D Culture Systems:

    • Establish bovine organoids expressing fluorescently tagged CNEP1R1

    • Study complex tissue-specific functions in controlled environments

    • Test physiological and pathological stimuli in near-native contexts
      These approaches will help bridge current knowledge gaps and provide more comprehensive understanding of bovine CNEP1R1 function in complex biological systems.

How might understanding bovine CNEP1R1 contribute to broader comparative research in membrane biology?

Investigation of bovine CNEP1R1 offers several opportunities for advancing comparative membrane biology:

  • Evolutionary Adaptation of ER Regulation:

    • Compare regulatory mechanisms across species with different metabolic demands

    • Identify conserved versus specialized functions in membrane homeostasis

    • Trace evolutionary history of CNEP1R1-CTDNEP1 complex

  • Species-Specific Membrane Composition:

    • Correlate CNEP1R1 function with differences in lipid profiles between species

    • Investigate adaptations related to temperature regulation and environmental factors

    • Examine membrane fluidity regulation across different mammals

  • Comparative Phosphatase Regulation:

    • Analyze differences in phosphatase regulatory mechanisms across species

    • Identify universal principles in membrane-associated enzyme regulation

    • Map regulatory networks across evolutionary distance

  • Translational Applications:

    • Develop insights applicable to human disease models

    • Inform agricultural applications for livestock health

    • Contribute to broader understanding of ER stress responses
      Research on bovine CNEP1R1 can serve as a valuable comparative reference point, given that crystal structures of human CTDNEP1-NEP1R1 have already revealed important mechanistic insights that may be conserved or divergent in bovine systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.