Recombinant Bovine Oligosaccharyltransferase complex subunit OSTC (OSTC)

Shipped with Ice Packs
In Stock

Description

OST Complex Composition

The OST complex varies across species but typically includes catalytic (e.g., STT3A/B) and non-catalytic subunits (e.g., OSTC, DDOST, DAD1). Bovine OSTC interacts with other subunits to optimize glycosylation efficiency .

SubunitRoleShared Pathways
OSTCNon-catalytic, enhances substrate bindingER-associated degradation (ERAD), protein folding
STT3A/BCatalytic, initiates glycosylationCotranslational glycosylation, post-translational modifications
DDOST (OST48)Stabilizes OST complexAdvanced glycation end-product processing, immune signaling

Role in N-Glycosylation and ER Quality Control

OSTC is essential for glycosylation of specific glycoproteins, including receptor kinases (e.g., EFR) and cellulose biosynthesis enzymes (e.g., KORRIGAN1) in plants. Mutations in OST3/6 (plant homolog of OSTC) lead to underglycosylation, compromised protein stability, and activation of the unfolded protein response (UPR) . In mammals, OSTC modulates γ-secretase cleavage of amyloid-beta precursor protein (APP) and interacts with the ERAD machinery, particularly the E3 ligase HRD1 .

Viral Glycosylation and Pathogenesis

Arenaviruses like Lassa virus (LASV) depend on STT3B-OST complexes for glycosylation of their glycoprotein precursors. Knockout of STT3B subunits (e.g., MAGT1, TUSC3) reduces LASV infectivity, highlighting OSTC’s conserved role in viral propagation .

Cancer and miRNA Regulation

In hepatocellular carcinoma (HCC), miR-1307 upregulates calreticulin (CALR) while downregulating OSTC, disrupting protein folding and promoting oncogenic signaling (e.g., H-Ras, PKM2 activation) . This dysregulation contributes to malignant proliferation, underscoring OSTC’s role in maintaining cellular homeostasis.

Applications in Research and Biotechnology

ApplicationDetailsRelevance
Protein Folding StudiesOSTC’s interaction with HRD1 facilitates ERAD, aiding in misfolded protein degradation .Therapeutic target for ER stress-related diseases.
Viral Vaccine DevelopmentBlocking STT3B-OST (via inhibitors like NGI-1) reduces arenavirus infectivity .Antiviral drug discovery.
Cancer Biomarker ResearchAltered OSTC expression correlates with miRNA-driven HCC progression .Diagnostic and therapeutic potential.

Product Specs

Form
Lyophilized powder

Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will fulfill your request to the best of our ability.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request but will incur additional charges. Please contact us in advance to arrange this.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline for your use.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.

Synonyms
OSTC; Oligosaccharyltransferase complex subunit OSTC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
OSTC
Target Protein Sequence
MESLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SVTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function

Recombinant Bovine Oligosaccharyltransferase complex subunit OSTC (OSTC) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation. N-glycosylation occurs co-translationally, and the OST complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity. OSTC may be involved in the N-glycosylation of APP (amyloid-beta precursor protein) and can modulate gamma-secretase cleavage of APP by enhancing PSEN1 endoproteolysis.

Database Links

KEGG: bta:768033

STRING: 9913.ENSBTAP00000050205

UniGene: Bt.3114

Protein Families
OSTC family
Subcellular Location
Endoplasmic reticulum. Membrane; Multi-pass membrane protein.

Q&A

What is the functional role of OSTC in the oligosaccharyltransferase complex?

OSTC serves as a critical transmembrane subunit within the oligosaccharyltransferase (OST) complex, which is responsible for N-glycosylation of proteins in the endoplasmic reticulum. The OST complex consists of a catalytic transmembrane subunit (either STT3A or STT3B) alongside several additional transmembrane proteins including DAD1, OST48/DDOST, TMEM258, OST4, ribophorin1, ribophorin2, and subunits that specifically interact with STT3A (including DC2/OSTC) or STT3B . OSTC plays a pivotal role in N-glycosylation, which is the primary post-translational modification of secretory proteins, transferring conserved oligosaccharides from lipid-linked glycan donors to asparagine residues in defined sequons of newly-synthesized proteins .

Recent evidence suggests OSTC may be involved in the endoplasmic reticulum-associated degradation (ERAD) pathway, indicating its function extends beyond glycosylation to protein quality control mechanisms .

What experimental models are appropriate for studying OSTC function?

When designing experiments to study OSTC function, researchers should consider multiple model systems to ensure robust and translatable results:

Cell Lines: Human hepatocellular carcinoma cell lines (e.g., Hep3B) have been effectively used to study OSTC's role in protein folding and cancer mechanisms . These models are particularly valuable when investigating OSTC's interactions with cell cycle regulators and autophagy-related proteins.

Animal Models: For in vivo studies, researchers should follow established protocols for animal research design:

  • Clearly establish the objective (e.g., measuring the effect of OSTC modulation on specific cellular pathways)

  • Select appropriate species and strains that allow extrapolation

  • Define precise variables to measure

  • Establish well-defined experimental groups (treatment vs. control)

  • Calculate appropriate sample sizes based on power analysis

  • Implement balanced blocking designs to control for confounding variables

When designing animal studies, follow the principle: "Control what you can, block what you cannot, and randomize the rest" . This approach minimizes experimental bias and enhances reproducibility.

What antibodies and detection methods are recommended for OSTC research?

For effective OSTC detection and analysis, researchers should select antibodies based on experimental requirements:

Antibody Selection: Peptide-affinity purified polyclonal antibodies raised against synthetic peptides from the C-terminal region (amino acids 90-117) of human OSTC have demonstrated cross-reactivity with mouse OSTC and predicted reactivity with Xenopus, bovine, chicken, zebrafish, and rat OSTC . When selecting an anti-OSTC antibody, consider:

  • Immunogen sequence position (e.g., positions 90-117)

  • Host species (e.g., rabbit)

  • Purification method (e.g., peptide affinity purification)

  • Species cross-reactivity

  • Validated applications (Western blot, immunoprecipitation, etc.)

Detection Methods:

  • For protein-protein interaction studies, co-immunoprecipitation (IP) has been successfully employed to analyze OSTC binding to proteins like CDK2, CDK4, cyclinD1, and cyclinE .

  • For assessing OSTC's role in retrotranslocation, biotinylation assays utilizing BirA have proven effective .

Keep detection antibodies at 2-8°C for up to 6 months, or store at -20°C in small aliquots for long-term preservation to prevent freeze-thaw cycles .

How should researchers design experiments to investigate OSTC's role in ER-associated degradation (ERAD)?

Recent studies have revealed OSTC's involvement in the ERAD pathway, necessitating carefully designed experiments to elucidate this function:

Recommended Experimental Approach:

  • Protein Retrotranslocation Assays: Utilize H2a-BAP (biotin acceptor peptide) reporter systems where BAP is positioned on the luminal C-terminus of H2a. This allows exposure to cytosolic BirA only after H2a-BAP retrotranslocation, enabling assessment of ERAD efficiency .

  • Modulation Strategies:

    • Overexpression: Use GFP-DAD1 constructs to observe effects on retrotranslocation ratios

    • Knockdown: Employ siRNA targeting DAD1 or Tusc3 to assess impact on ERAD substrate processing

    • Inhibition: Apply protein misfolding inhibitors (e.g., silibinin) to determine pathway specificity

  • Interaction Analysis:

    • Perform co-immunoprecipitation assays to identify OSTC interactions with HRD1 and other ERAD components

    • Utilize proximity labeling techniques to capture transient interactions within the ERAD machinery

When analyzing results, calculate the ratio of retrotranslocated molecules relative to total protein to accurately assess ERAD efficiency. In previous studies, GFP-DAD1 overexpression resulted in a significant increase in this ratio compared to controls, while knockdown of DAD1 or Tusc3 decreased it .

What methodological considerations are important when investigating OSTC's influence on protein folding pathways?

OSTC plays a critical role in protein folding pathways, requiring specific methodological approaches to accurately assess its function:

Key Methodological Considerations:

  • Protein Interaction Assessment:

    • Implement protein immunoprecipitation (IP) analysis to evaluate binding abilities between OSTC and substrate proteins

    • When studying interactions between OSTC and proteins like H-Ras, PKM2, and PLK1, include appropriate controls to account for non-specific binding

  • Activity Measurement:

    • For measuring activities of proteins affected by OSTC (e.g., H-ras, PKM2), use specific assays such as GlycoPER for PKM2 activity

    • Incorporate protein misfolding inhibitors (e.g., silibinin) as experimental controls to establish pathway specificity

  • Autophagy Assessment:

    • When investigating OSTC's impact on autophagy, employ LC3 HiBiT-reporter assays, where autophagy rate is inversely proportional to reporter values

    • Analyze the binding abilities of autophagy components (ATG4, LC3, ATG3, ATG7) through co-immunoprecipitation

A comprehensive experimental design should incorporate both gain-of-function (overexpression) and loss-of-function (knockdown) approaches to establish causality in OSTC's roles in protein folding pathways. Published studies have demonstrated significant differences in protein activities between control groups and OSTC-modulated groups, with PKM2 activity showing a nearly four-fold increase (GlycoPER: 2.25 ± 0.37 versus 8.62 ± 0.58, p = 0.00036) following miR-1307-mediated OSTC modulation .

How can conflicting data regarding OSTC function be reconciled in research studies?

When faced with conflicting data regarding OSTC function, researchers should apply systematic approaches to data reconciliation:

Recommended Reconciliation Strategies:

  • Evaluate Methodological Differences:

    • Compare experimental design parameters including cell lines, expression systems, and assay conditions

    • Assess timing of measurements, as OSTC's effects may be dependent on cell cycle stage or disease progression

    • Consider differences in protein expression levels across studies, as over-expression artifacts can occur

  • Analyze Model System Variations:

    • OSTC function may differ between in vitro and in vivo models

    • Species-specific differences in OSTC function may exist, requiring careful cross-species validation

    • Disease models may show altered OSTC function compared to normal physiological states

  • Implement Meta-Analysis Approaches:

    • When appropriate, apply statistical meta-analysis techniques to integrate findings across multiple studies

    • Calculate effect sizes and confidence intervals to quantify the magnitude and precision of OSTC's effects

    • Assess heterogeneity across studies to identify potential moderating variables

  • Address Sample Size and Power Concerns:

    • Evaluate whether conflicting results may stem from underpowered studies

    • Consider replication studies with larger sample sizes to resolve contradictions

    • Apply statistical correction methods for multiple comparisons

A meta-analysis approach similar to that employed by Sciety in their 2025 review of Open Science impacts can provide valuable insights into resolving conflicting data, identifying both positive and mixed impacts while acknowledging unintended negative consequences of research approaches .

What are the critical factors in designing statistically robust experiments for OSTC research?

Designing statistically robust experiments for OSTC research requires careful consideration of several critical factors:

Key Design Factors:

  • Sample Size Determination:

    • Conduct power analysis prior to experimentation to determine appropriate sample sizes

    • Consider effect size expectations based on pilot studies or literature

    • Account for potential attrition or technical failures in sample size calculations

  • Experimental Layout Design:

    • Implement balanced blocking designs to control for variables not directly under investigation

    • Variables to consider blocking include: sex of experimental animals, time of day for measurements, technician effects, and cage positioning

    • For example, when using both male and female animals, ensure equal distribution across treatment groups (e.g., 3 control males, 3 treated males, 3 control females, 3 treated females)

  • Randomization Implementation:

    • Randomize the order of experimental procedures and measurements to prevent systematic bias

    • Use computer-generated randomization rather than human-generated sequences, as humans tend to create regular patterns

    • Create an explicit measurement plan documenting the randomization scheme

Example Experimental Measurement Plan:

Time of DaySample Processing Order
Morning(a) Male control
(b) Female treatment
(c) Female treatment
(d) Female control
(e) Male treatment
(f) Male control
Afternoon(a) Male treatment
(b) Male treatment
(c) Female control
(d) Female control
(e) Male control
(f) Female treatment

This randomized measurement plan helps prevent confounding variables from biasing experimental outcomes .

How should researchers approach the characterization of OSTC in different disease models?

When characterizing OSTC in disease models, researchers should employ systematic approaches that account for disease-specific considerations:

Methodological Recommendations:

  • Disease Model Selection:

    • Choose models that recapitulate key aspects of the disease pathology

    • For liver cancer studies, Hep3B cells have been effectively used to study OSTC's role in hepatocarcinogenesis

    • For metabolic disorders, consider models with relevant phenotypes, as OSTC may function differently in metabolic disease contexts

  • Multi-Parameter Assessment:

    • Evaluate OSTC expression levels using both transcriptomic and proteomic approaches

    • Assess subcellular localization of OSTC, as disease states may alter its distribution

    • Analyze OSTC's interactions with binding partners, which may be modified in disease conditions

  • Functional Impact Analysis:

    • Measure downstream effects of OSTC modulation on:

      • Cell cycle regulation (CDK2, CDK4, CyclinD1, cyclinE interactions)

      • Oncogenic signaling (H-Ras, PKM2, PLK1 activities)

      • Autophagy pathways (ATG4, LC3, ATG3, ATG7 interactions)

  • Translational Validation:

    • Validate findings in multiple model systems

    • When transitioning from in vitro to in vivo models, implement appropriate controls

    • Consider xenograft models to assess OSTC's role in tumor growth and development

In a hepatocarcinogenesis study, researchers demonstrated that OSTC knockdown abrogated the carcinogenic effects observed in liver cancer cells, with significant differences in xenograft tumor weight (0.409 ± 0.104 g versus 0.378 ± 0.046 g, p = 0.21727), tumor appearance time (10.5 ± 1.9 days versus 9.8 ± 2.25 days, p = 0.128), and PCNA expression .

What controls should be included when studying OSTC's interactions with other proteins?

Proper control implementation is essential when studying OSTC's interactions with other proteins to ensure valid and reproducible results:

Essential Controls:

  • Input Controls:

    • Include whole cell lysate samples (input) in co-immunoprecipitation experiments to confirm the presence of proteins of interest prior to pulldown

    • Quantify input levels for normalization of interaction data

  • Negative Controls:

    • Use isotype-matched irrelevant antibodies for immunoprecipitation to assess non-specific binding

    • Implement IgG controls to account for background signal

    • Include non-interacting protein controls to validate specificity of observed interactions

  • Positive Controls:

    • Include known OSTC interaction partners (e.g., other OST complex components) to validate assay functionality

    • Use established protein-protein interaction pairs within your experimental system

  • Competition Controls:

    • Where applicable, perform competition experiments with excess unlabeled proteins to demonstrate specificity of interactions

    • Utilize peptide blocking to confirm antibody specificity in immunoprecipitation experiments

  • Pathway Intervention Controls:

    • Implement protein misfolding inhibitors (e.g., silibinin) to establish pathway specificity

    • Include both overexpression and knockdown approaches to establish causality

    • For CALR-OSTC-protein folding pathway studies, include CALR knockdown and OSTC overexpression controls to validate findings

Research has demonstrated that OSTC interacts with multiple proteins including CDK2, CDK4, CyclinD1, cyclinE, H-Ras, PKM2, and PLK1. These interactions can be effectively studied through co-immunoprecipitation with appropriate controls, revealing significant changes in binding abilities under different experimental conditions .

How should researchers analyze and interpret OSTC expression data across different experimental conditions?

Analytical Framework:

  • Normalization Strategies:

    • For Western blot analysis, normalize OSTC expression to appropriate housekeeping proteins (e.g., β-actin, GAPDH)

    • For RT-qPCR, use validated reference genes with demonstrated stability under your experimental conditions

    • Account for potential differences in protein loading through total protein normalization methods

  • Statistical Analysis:

    • Apply appropriate statistical tests based on data distribution and experimental design

    • For normally distributed data, use parametric tests (t-tests, ANOVA)

    • For non-normally distributed data, apply non-parametric alternatives or appropriate transformations

    • Include multiple comparison corrections when analyzing OSTC expression across several conditions

  • Visualization Methods:

    • Present data using appropriate graphical formats (bar graphs, box plots) with error bars representing standard deviation or standard error

    • Provide representative images of Western blots alongside quantification

    • Include all data points in visualizations to demonstrate data distribution

  • Context-Specific Interpretation:

    • Consider tissue-specific or cell-type-specific baseline OSTC expression levels

    • Interpret changes in OSTC expression relative to disease progression or treatment response

    • Account for potential post-translational modifications affecting OSTC detection

In research examining OSTC's role in hepatocarcinogenesis, significant differences in protein expression were observed following experimental manipulations, with clear statistical significance (p < 0.01) demonstrated between control and experimental groups . These findings should be interpreted within the context of the specific disease model and experimental conditions used.

What approaches should be used to analyze OSTC's role in complex molecular pathways?

Analyzing OSTC's role in complex molecular pathways requires sophisticated approaches that capture multi-dimensional interactions:

Recommended Analytical Approaches:

  • Pathway Analysis Methods:

    • Employ both targeted and unbiased approaches to identify pathways influenced by OSTC

    • Use gene set enrichment analysis (GSEA) to identify significantly affected pathways

    • Apply network analysis to map OSTC's position within protein interaction networks

  • Multi-omics Integration:

    • Combine transcriptomic, proteomic, and functional data to comprehensively assess OSTC's impact

    • Use computational tools to integrate datasets across different experimental platforms

    • Apply dimensionality reduction techniques to identify key factors in OSTC-regulated pathways

  • Temporal Analysis:

    • Consider time-course experiments to capture dynamic changes in OSTC function

    • Analyze temporal relationships between OSTC modulation and downstream effects

    • Implement mathematical modeling to predict pathway behavior following OSTC perturbation

  • Causal Inference Methods:

    • Use intervention studies (knockdown, overexpression, inhibition) to establish causality

    • Apply causal inference statistical methods when direct intervention is not possible

    • Triangulate evidence across multiple experimental approaches

Research has demonstrated OSTC's involvement in multiple pathways including protein folding, cell cycle regulation, oncogenic signaling, and autophagy. For example, in hepatocarcinogenesis, miR-1307 modulation of OSTC resulted in significant changes in the binding abilities of OSTC with CDK2, CDK4, CyclinD1, and cyclinE, leading to downstream effects on p21WAF1/CIP1, GADD45, pRB, and P18 expression . These complex interactions require sophisticated analytical approaches to fully elucidate OSTC's functional role.

How can researchers effectively compare and integrate findings from different studies on OSTC function?

Effective comparison and integration of findings from different OSTC studies requires systematic approaches to harmonize diverse data:

Integration Strategies:

  • Systematic Review Methodology:

    • Follow established guidelines (e.g., PRISMA) for systematic reviews

    • Clearly define inclusion and exclusion criteria for study selection

    • Assess study quality using standardized tools to identify potential biases

  • Meta-analysis Techniques:

    • When appropriate, apply statistical meta-analysis to quantitatively synthesize findings

    • Calculate effect sizes to standardize outcomes across different metrics

    • Assess heterogeneity to identify sources of variation between studies

    • Use random-effects models when heterogeneity is present

  • Comparative Analysis Frameworks:

    • Develop standardized frameworks for comparing OSTC function across studies

    • Consider experimental context (cell type, disease model, assay conditions)

    • Account for methodological differences in OSTC detection and quantification

  • Data Harmonization Approaches:

    • Standardize data formats and reporting metrics

    • Normalize findings to common reference points when possible

    • Apply computational methods to reconcile differences in experimental platforms

The 2025 Open Science scoping review by Sciety provides a model for this approach, synthesizing findings from 485 studies through systematic analysis to identify key impacts and gaps in the literature . For OSTC research, a similar approach could identify consensus findings regarding OSTC function while highlighting areas of uncertainty requiring further investigation.

How does OSTC function compare between bovine models and other species?

Understanding cross-species variations in OSTC function is crucial for translational research:

Cross-Species Considerations:

  • Sequence and Structural Conservation:

    • OSTC exhibits conservation across mammalian species, with antibodies raised against human OSTC showing cross-reactivity with mouse OSTC and predicted reactivity with bovine, chicken, rat, Xenopus, and zebrafish OSTC

    • Key functional domains, particularly the C-terminal region (amino acids 90-117), show high conservation across species

  • Functional Comparison:

    • The core functions of OSTC in N-glycosylation appear conserved across mammalian species

    • Species-specific variations may exist in OSTC's interactions with other proteins, potentially reflecting evolutionary adaptations in protein quality control mechanisms

    • When extrapolating findings from bovine models to other species, consider potential differences in expression levels and regulatory mechanisms

  • Methodological Approaches for Cross-Species Studies:

    • Use sequence alignment and phylogenetic analysis to identify conserved functional domains

    • Employ comparative functional assays to assess conservation of OSTC activity

    • Consider the use of cross-species complementation experiments to evaluate functional equivalence

How should researchers approach the relationship between OSTC and bovine somatotropin (BST) in experimental studies?

The relationship between OSTC and bovine somatotropin (BST) represents a complex area of investigation requiring careful experimental design:

Research Approach Recommendations:

  • Distinguishing Functional Relationships:

    • BST (bovine somatotropin) is a metabolic hormone that controls milk production in cattle, while OSTC functions in protein quality control and N-glycosylation pathways

    • Design experiments to specifically distinguish between direct interactions and indirect pathway effects

    • Use time-course studies to establish temporal relationships between BST administration and changes in OSTC expression or function

  • Methodological Considerations for Combined Studies:

    • When studying potential interactions between OSTC and recombinant BST (rbST):

      • Include appropriate controls for both rbST treatment and OSTC modulation

      • Consider potential confounding factors such as dosage effects and timing of administration

      • Design randomized controlled trials with adequate power to detect interaction effects

  • Safety and Ethical Considerations:

    • rbST has been associated with increased risk of mastitis in cattle (approximately 25% increase), as well as lameness (55% increase)

    • OSTC studies involving rbST should monitor these potential adverse effects

    • Include appropriate animal welfare assessments in experimental design

A meta-analysis approach similar to that conducted by the Canadian Veterinary Medical Association for rbST effects could be valuable for synthesizing findings on OSTC-BST relationships, combining data from randomized clinical trials while accounting for methodological differences between studies .

What are the most effective assays for measuring OSTC activity in research settings?

Measuring OSTC activity requires specialized assays designed to capture its functional role:

Recommended Assay Approaches:

  • Protein Interaction Assays:

    • Co-immunoprecipitation (Co-IP): Effective for studying OSTC's interactions with binding partners such as CDK2, CDK4, CyclinD1, cyclinE, H-Ras, PKM2, and PLK1

    • Proximity Ligation Assay (PLA): Useful for detecting and visualizing protein-protein interactions within intact cells

    • FRET-based assays: Enable real-time monitoring of OSTC interactions with high spatial resolution

  • Functional Activity Assays:

    • Retrotranslocation Assays: Use H2a-BAP reporter systems with cytosolic BirA to measure ERAD efficiency

    • Glycosylation Efficiency Assays: Monitor N-glycosylation of model substrates to assess OST complex function

    • Protein Folding Monitoring: Assess effects on downstream protein folding pathways through reporter systems

  • Localization and Dynamics Assays:

    • Fluorescent Fusion Proteins: Monitor OSTC subcellular localization and dynamics

    • Photoactivatable and Photoconvertible Tags: Track OSTC movement between cellular compartments

    • FRAP (Fluorescence Recovery After Photobleaching): Measure OSTC mobility within membranes

  • High-Throughput Screening Approaches:

    • CRISPR-based Screens: Identify genetic interactors and modifiers of OSTC function

    • Small Molecule Screening: Discover compounds that modulate OSTC activity

    • Synthetic Genetic Array Analysis: Map genetic interaction networks involving OSTC

For quantitative assessment of OSTC's effect on protein retrotranslocation, researchers have successfully employed biotinylation assays that measure the ratio of retrotranslocated molecules relative to total protein, demonstrating significant differences between control and experimental conditions .

How can researchers develop reliable and sensitive detection methods for OSTC in complex biological samples?

Developing reliable and sensitive OSTC detection methods for complex samples requires careful consideration of multiple factors:

Development Recommendations:

  • Antibody-Based Detection Optimization:

    • Select antibodies targeting conserved epitopes, such as those in the C-terminal region (amino acids 90-117)

    • Validate antibody specificity through multiple approaches:

      • Western blotting with positive and negative controls

      • Peptide competition assays

      • Knockdown/knockout validation

      • Cross-reactivity assessment

  • Mass Spectrometry-Based Approaches:

    • Develop targeted MS assays (e.g., MRM/PRM) for OSTC detection in complex samples

    • Identify reliable proteotypic peptides unique to OSTC

    • Implement internal standards for accurate quantification

    • Consider post-translational modifications that might affect detection

  • Sample Preparation Considerations:

    • Optimize membrane protein extraction methods specific to OSTC's properties:

      • Evaluate different detergents for solubilization

      • Consider gentle extraction methods to preserve protein-protein interactions

      • Implement fractionation approaches to enrich for OSTC-containing compartments

  • Validation and Quality Control:

    • Establish assay reproducibility across different sample types

    • Determine limits of detection and quantification

    • Assess matrix effects that might interfere with OSTC detection

    • Implement appropriate normalization strategies

When developing antibody-based detection methods, researchers should consider that peptide-affinity purified antibodies against the C-terminal region of OSTC have demonstrated good specificity and cross-reactivity across multiple species, making them potentially valuable tools for OSTC detection in diverse experimental contexts .

What are the current methodological limitations in OSTC research and how might they be addressed?

Current OSTC research faces several methodological challenges that require innovative solutions:

Key Limitations and Solutions:

  • Membrane Protein Analysis Challenges:

    • Limitation: As a transmembrane protein, OSTC presents difficulties in solubilization and structural analysis

    • Solution: Implement advanced membrane protein structural biology approaches including cryo-EM, native mass spectrometry, and computational modeling to elucidate OSTC structure and interactions

  • Temporal and Spatial Resolution:

    • Limitation: Current methods often lack sufficient temporal and spatial resolution to capture dynamic OSTC functions

    • Solution: Develop live-cell imaging approaches with optogenetic tools to manipulate and monitor OSTC activity with high spatiotemporal precision

  • Complex Interaction Networks:

    • Limitation: OSTC functions within complex protein networks that are challenging to dissect

    • Solution: Apply systems biology approaches, including protein correlation profiling and interaction proteomics, to comprehensively map OSTC's interaction landscape across different conditions

  • Translational Relevance:

    • Limitation: Connecting basic OSTC biology to disease mechanisms remains challenging

    • Solution: Develop disease-relevant models and patient-derived systems to establish the pathophysiological significance of OSTC alterations

  • Reproducibility Concerns:

    • Limitation: Variability in experimental conditions leads to inconsistent findings

    • Solution: Implement standardized protocols and reporting guidelines specifically for OSTC research, ensuring transparent description of key methodological details

Addressing these limitations will require interdisciplinary approaches combining advanced biochemical techniques with computational methods and systems biology frameworks to fully elucidate OSTC's functional roles in normal physiology and disease states.

What emerging technologies hold promise for advancing OSTC research?

Several emerging technologies offer significant potential for advancing OSTC research:

Promising Technologies:

  • CRISPR-Based Technologies:

    • Base and prime editing for precise OSTC modification without complete knockout

    • CRISPRi/CRISPRa for reversible modulation of OSTC expression

    • CRISPR screens to systematically identify OSTC genetic interactors

  • Advanced Imaging Approaches:

    • Super-resolution microscopy to visualize OSTC within the ER membrane environment

    • Correlative light and electron microscopy (CLEM) to connect OSTC localization with ultrastructural features

    • Lattice light-sheet microscopy for long-term 3D imaging of OSTC dynamics

  • Protein Engineering Methods:

    • Split protein complementation assays optimized for membrane protein interactions

    • Proximity labeling techniques (BioID, APEX) to map OSTC's local interactome

    • Synthetic biology approaches to create designer OSTC variants with modified functions

  • Single-Cell Technologies:

    • Single-cell proteomics to capture cell-to-cell variability in OSTC expression and function

    • Spatial transcriptomics to analyze OSTC expression patterns in tissue contexts

    • Multi-modal single-cell analysis integrating genomic, transcriptomic, and proteomic data

  • Artificial Intelligence Applications:

    • Machine learning for prediction of OSTC structural features and interaction partners

    • Deep learning algorithms to identify patterns in large-scale OSTC functional data

    • AI-assisted experimental design to optimize OSTC research approaches

The integration of these technologies with established biochemical and cellular approaches has the potential to significantly advance our understanding of OSTC biology and its implications for health and disease.

How can researchers contribute to open science practices in the field of OSTC research?

Implementing open science practices in OSTC research can accelerate scientific progress and enhance reproducibility:

Open Science Implementation Strategies:

  • Data Sharing Approaches:

    • Deposit raw data in field-appropriate repositories (e.g., PRIDE for proteomics, GEO for transcriptomics)

    • Share detailed protocols on platforms like Protocol Exchange or protocols.io

    • Implement FAIR data principles: Findable, Accessible, Interoperable, and Reusable

  • Preregistration and Reporting:

    • Preregister experimental designs, especially for complex studies

    • Use reporting checklists relevant to OSTC research (e.g., ARRIVE guidelines for animal studies)

    • Clearly document statistical methods and sample size calculations

  • Collaborative Frameworks:

    • Establish collaborative networks focused on OSTC research

    • Implement multi-laboratory validation studies for key findings

    • Develop community standards for OSTC-specific methodologies

  • Open Access Publication:

    • Publish in open access journals or utilize preprint servers

    • Include detailed supplementary methods and data

    • Consider publishing negative results to address publication bias

  • Resource Sharing:

    • Share research tools including cell lines, antibodies, and genetic constructs

    • Develop and distribute standardized reagents for OSTC research

    • Contribute to community databases relevant to OSTC function

According to a 2025 scoping review, Open Science practices not only improve accessibility and transparency but also enhance scientific efficiency, quality, and reproducibility, though challenges related to equity and inclusion must be carefully addressed . By implementing these practices, OSTC researchers can contribute to a more robust and collaborative research ecosystem.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.