Recombinant Bovine Opalin (OPALIN)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Opalin (OPALIN)

Recombinant Bovine Opalin, also known as OPALIN, is a transmembrane protein derived from bovine sources. It is part of the oligodendrocytic myelin paranodal and inner loop protein family, which plays a crucial role in the central nervous system (CNS) myelin structure. This protein is primarily involved in the formation and maintenance of myelin sheaths around axons, facilitating efficient neural transmission.

Structure and Function

Opalin is a type 1 transmembrane protein with a short N-terminal extracellular domain and a long C-terminal cytoplasmic domain. The N-terminal domain contains glycosylation sites, which are essential for its function and stability. The protein is highly conserved across mammalian species, indicating its importance in myelin biology.

FeatureDescription
TypeType 1 transmembrane protein
DomainsShort N-terminal extracellular domain, long C-terminal cytoplasmic domain
GlycosylationContains N-linked glycosylation sites
ConservationHighly conserved across mammalian species

Research Findings

While specific research on Recombinant Bovine Opalin is limited, studies on its mammalian counterparts suggest that Opalin plays a significant role in myelin development and maintenance. It is predominantly expressed in the CNS, particularly in white matter-rich regions, and is up-regulated during postnatal myelination stages. The protein's involvement in diseases like multiple sclerosis highlights its importance in neurological health.

Expression LocationDisease Association
Central nervous system (CNS)Multiple sclerosis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OPALIN; TMEM10; Opalin; Oligodendrocytic myelin paranodal and inner loop protein; Transmembrane protein 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
OPALIN
Target Protein Sequence
MSFSLNFTLPANTTSSPVVTSGKGADCGPSLGLAAGIPSLVATALLVALLLILIHRRRRS SESTEEIERPCEISEIYDNPRVAENPRRSPTHEKNIMGAEEAHIYVKTVSGSQEPMRDTY RPAVEMERRRGLWWLIPRLSLE
Uniprot No.

Target Background

Function

Recombinant Bovine Opalin (OPALIN) is a central nervous system-specific myelin protein that enhances the expression of myelin genes during oligodendrocyte differentiation and promotes their terminal differentiation.

Database Links

UniGene: Bt.97215

Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is OPALIN and what are its primary functions in the central nervous system?

OPALIN (Oligodendrocytic myelin paranodal and inner loop protein, also known as TMEM10) is a type I transmembrane protein specifically expressed on oligodendrocytes (OLs) . It plays a crucial role in myelination processes within the central nervous system. Recent research has identified OPALIN as a receptor for Leucine-rich glioma-inactivated protein 1 (LGI1), forming a complex that orchestrates oligodendrocyte differentiation and myelination . The protein functions through regulation of the Olig2/Sox10/Myrf axis, which are transcription factors critical for oligodendrocyte differentiation . Knockout studies have demonstrated that OPALIN deficiency results in hypomyelination and white matter abnormalities (WMAs), phenocopying LGI1 deficiency in mice .

How does recombinant bovine OPALIN differ from native OPALIN?

Recombinant bovine OPALIN is produced through expression systems rather than extracted from natural tissue sources. While the amino acid sequence remains identical to native OPALIN, potential differences may exist in post-translational modifications. The recombinant protein is typically stored in Tris-based buffer with 50% glycerol, optimized for protein stability . Researchers should note that recombinant proteins may lack certain tissue-specific modifications that could affect some functional aspects, though the core binding properties and structural domains remain intact for experimental purposes.

What expression systems are most effective for producing recombinant bovine OPALIN?

For optimal expression, researchers should consider:

  • Codon optimization for the selected expression system

  • Addition of appropriate purification tags that don't interfere with OPALIN's functional domains

  • Careful selection of signal peptides for proper membrane localization

  • Expression conditions that minimize protein aggregation

What are the recommended protocols for analyzing OPALIN-LGI1 interactions in vitro?

Based on published research methodologies, the OPALIN-LGI1 interaction can be effectively studied through:

  • Co-immunoprecipitation assays: LGI1-3×FLAG affinity chromatography with brain lysates followed by mass spectrometry has successfully identified OPALIN as an LGI1-binding protein . For targeted experiments, researchers can use anti-FLAG antibodies to pull down tagged LGI1 and detect OPALIN by Western blotting.

  • Site-directed mutagenesis: Creating OPALIN variants with mutations at key residues (particularly K23A/D26A) to validate the binding interface with LGI1 .

  • Binding affinity measurements: Surface plasmon resonance or microscale thermophoresis can quantify the strength of OPALIN-LGI1 interactions and determine how various conditions affect binding kinetics.

  • Domain mapping experiments: Using truncated versions of OPALIN to determine which regions beyond the identified K23/D26 residues contribute to LGI1 binding.

How can researchers design experiments to study the effects of OPALIN on oligodendrocyte differentiation?

Research on OPALIN's role in oligodendrocyte differentiation can be approached through:

  • Conditional knockout models: Creating oligodendrocyte lineage-specific OPALIN knockout mice (Opalin^cKO) using Cre-loxP technology, as demonstrated in recent studies .

  • Rescue experiments: Adeno-associated virus (AAV)-mediated expression of wild-type OPALIN or binding-deficient mutants (OPALIN_K23A/D26A) in OPALIN-deficient mice to assess functional recovery .

  • Differentiation assays: Culturing oligodendrocyte precursor cells (OPCs) with or without recombinant OPALIN protein to assess differentiation markers like MBP, PLP, and CNP.

  • Analysis of transcription factor expression: Measuring levels of Olig2, Sox10, and Myrf through RT-PCR, Western blotting, and immunohistochemistry to assess the impact on the differentiation pathway .

  • mTOR signaling assessment: Evaluating phosphorylation of mTOR, S6K, and S6 to understand the signaling mechanisms affected by OPALIN, as altered mTOR signaling has been observed in OPALIN-deficient models .

What experimental design considerations optimize reproducibility in OPALIN research using animal models?

When designing animal experiments to study OPALIN function:

  • Mini-experiment approach: Rather than testing all animals under strictly standardized conditions at one time point, divide the experiment into smaller "mini-experiments" with slight variations in laboratory conditions (noise, temperature, etc.). This approach has been shown to improve reproducibility in animal research .

  • Biological variation incorporation: Ensure that real-life biological variation is reflected in laboratory conditions. Studies have demonstrated that this design modification significantly enhances the reproducibility of results compared to conventional standardized designs .

  • Temporal spacing: Conduct mini-experiments with several weeks between each session to account for seasonal and environmental variations .

  • Statistical power calculation: Determine appropriate sample sizes based on expected effect sizes and variability. The mini-experiment design may require adjustment of total animal numbers to maintain statistical power.

  • Multiple endpoints analysis: Assess OPALIN function using various complementary techniques (e.g., molecular, cellular, and behavioral measures) to provide converging evidence.

How can researchers effectively analyze contradictory findings in OPALIN-mediated myelination studies?

When faced with contradictory results in OPALIN research:

  • Age-dependent effects analysis: Compare results across different developmental time points, as OPALIN's role may vary during early development versus adulthood.

  • Regional specificity assessment: Analyze whether contradictory findings might be explained by brain region-specific effects, as myelination processes can differ across CNS regions.

  • Sex-based differences: Systematically compare results between male and female subjects, as myelin-related proteins can exhibit sex-specific expression patterns.

  • Methodological comparison: Create a comprehensive table comparing key methodological differences between contradictory studies:

Study ParameterStudy AStudy BPotential Impact on Results
Animal strain[strain info][strain info]Genetic background effects
Age of animals[age range][age range]Developmental differences
OPALIN variant[details][details]Functional domain variations
Detection method[method][method]Sensitivity/specificity differences
Region analyzed[region][region]Regional expression variations
  • Signaling pathway overlap: Evaluate whether contradictory findings might reflect parallel or compensatory pathways, particularly examining the interplay between OPALIN-LGI1 and other myelination regulators.

What are the molecular mechanisms by which OPALIN regulates the Olig2/Sox10/Myrf transcription factor axis?

Current research indicates that OPALIN regulates the critical oligodendrocyte differentiation pathway through:

  • mTOR signaling modulation: OPALIN deficiency leads to increased phosphorylation of mTOR, S6K, and S6, suggesting that OPALIN normally suppresses mTOR pathway activation . Enhanced mTOR activity has been shown to inhibit Olig2 and Sox10 expression .

  • LGI1-dependent signaling: The interaction between OPALIN and LGI1 is essential for proper oligodendrocyte differentiation, as demonstrated by the failure of LGI1-binding deficient OPALIN (K23A/D26A) to rescue the hypomyelination phenotype in OPALIN knockout mice .

  • Transcriptional regulation: OPALIN deficiency results in decreased protein levels of Olig2 and Sox10, key transcription factors for oligodendrocyte differentiation . This is accompanied by a reduction in Myrf-positive cells and decreased Myrf protein and mRNA levels .

  • Differentiation pathway: The molecular sequence appears to involve OPALIN-LGI1 interaction → mTOR pathway regulation → Olig2/Sox10 expression → Myrf activation → oligodendrocyte differentiation and myelination .

To thoroughly investigate these mechanisms, researchers should consider combinations of:

  • Chromatin immunoprecipitation to assess transcription factor binding to target genes

  • Phosphoproteomics to identify signaling cascades downstream of OPALIN-LGI1

  • Time-course experiments to establish the sequence of molecular events

  • Protein-protein interaction studies to identify additional OPALIN binding partners

What are the optimal methods for detecting and quantifying recombinant bovine OPALIN in experimental systems?

For effective detection and quantification of OPALIN:

  • ELISA-based detection: Commercial ELISA kits for recombinant bovine OPALIN can provide quantitative measurement with high sensitivity . These assays can be optimized for detection in various sample types by adjusting sample preparation protocols.

  • Western blotting: Using antibodies against OPALIN or epitope tags (if the recombinant protein includes tags). This method allows detection of both total protein levels and potential post-translational modifications through band shift analysis.

  • Immunocytochemistry/Immunohistochemistry: For visualization of OPALIN localization in cells or tissues, particularly useful for assessing membrane versus intracellular distribution.

  • qRT-PCR: While not detecting the protein directly, quantifying OPALIN mRNA can provide valuable information about expression levels in response to experimental manipulations.

  • Mass spectrometry: For detailed characterization of recombinant OPALIN, including verification of sequence integrity and identification of post-translational modifications.

How can gene expression targeting techniques be optimized for studying OPALIN in specific cell populations?

Drawing from related gene targeting approaches in neural cells:

  • Promoter selection: Cell-specific promoters can target gene expression to desired populations. For oligodendrocyte-specific expression, promoters like CNP have shown efficacy, as demonstrated in AAV delivery of OPALIN (using hCNP promoter) .

  • Vector selection: AAV vectors have demonstrated successful delivery of OPALIN to oligodendrocytes when injected into the lateral ventricles of neonatal mice . Different AAV serotypes have varying tropism for oligodendrocytes, with AAV5 showing superior transduction efficiency (approximately 20-fold higher than AAV2) in retinal photoreceptors , suggesting potential benefits for neural cell targeting.

  • Timing of intervention: For developmental studies, intervention at postnatal day 0 (P0) has been effective for targeting oligodendrocyte lineage cells through ventricular injection .

  • Expression verification: Using reporter genes (such as EGFP) co-expressed with OPALIN through an IRES element allows for easy visualization of transduced cells .

  • Quantitative assessment: To evaluate targeting efficiency, researchers should quantify the percentage of target cells (e.g., Sox10+ oligodendrocytes) expressing the transgene through co-immunostaining methods.

What are the cutting-edge techniques for studying OPALIN's role in myelin formation and maintenance?

Advanced methodologies for investigating OPALIN function in myelination include:

  • Live imaging of myelination: Using fluorescently tagged OPALIN constructs in combination with myelin markers to visualize the dynamics of myelin formation in real-time using high-resolution microscopy.

  • Single-cell RNA sequencing: Profiling transcriptional changes in oligodendrocyte lineage cells with or without functional OPALIN to identify gene networks regulated by OPALIN-LGI1 signaling.

  • CRISPR-based approaches: Generating precise modifications in the OPALIN gene to study specific functional domains or phosphorylation sites without completely ablating the protein.

  • Brain organoid models: Developing 3D culture systems containing oligodendrocytes and neurons to study OPALIN's role in human-relevant myelination processes.

  • Advanced MRI techniques: Utilizing diffusion tensor imaging (DTI) and magnetization transfer ratio (MTR) measurements to quantitatively assess myelin integrity in OPALIN-deficient animal models, similar to the techniques used to detect white matter abnormalities in OPALIN knockout mice .

How does bovine OPALIN compare to human OPALIN in structure and function?

While the search results don't provide direct comparative information between bovine and human OPALIN, we can infer:

  • Evolutionary conservation: As a protein involved in the fundamental process of myelination, OPALIN likely maintains conserved functional domains across species, particularly in the N-terminal region critical for LGI1 binding.

  • Functional equivalence: Research shows that the LGI1-OPALIN interaction is critical for oligodendrocyte differentiation in mouse models , suggesting this mechanism is likely conserved in bovine and human systems.

  • Expression patterns: OPALIN is specifically expressed in oligodendrocytes across mammalian species, indicating conservation of cell-type specificity .

  • Developmental timing: Comparative studies would be valuable to determine whether the temporal expression pattern of OPALIN during development is consistent across species.

For rigorous comparative analysis, researchers should perform sequence alignment studies and functional assays using both bovine and human OPALIN variants.

What insights from OPALIN research might contribute to understanding demyelinating disorders?

OPALIN research offers several translational insights for demyelinating disorders:

  • LGI1-related pathologies: The identification of OPALIN as a receptor for LGI1 provides a molecular mechanism potentially relevant to LGI1-related demyelinating diseases . Therapeutic approaches targeting this interaction could be developed.

  • Oligodendrocyte differentiation: OPALIN's role in regulating the Olig2/Sox10/Myrf transcription factor cascade suggests potential intervention points for promoting remyelination in disorders characterized by myelin loss .

  • mTOR pathway modulation: The observation that OPALIN deficiency leads to enhanced mTOR signaling connects to a pathway already implicated in multiple sclerosis and other demyelinating conditions, suggesting potential therapeutic avenues through mTOR modulation.

  • White matter abnormalities: The hypomyelination and white matter abnormalities observed in OPALIN-deficient mice mirror aspects of human demyelinating disorders, making these models potentially valuable for testing therapeutic approaches.

  • Gene therapy potential: The successful rescue of myelination deficits through AAV-mediated OPALIN expression demonstrates proof-of-concept for gene therapy approaches that could be adapted for certain demyelinating conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.