Recombinant Bovine Organic solute transporter subunit alpha (OSTA)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Bovine OSTA is a partial-length protein derived from Bos taurus (Bovine), corresponding to residues 1–340 of the full-length organic solute transporter subunit alpha. It forms a heterodimer with OSTβ, enabling bidirectional transport of bile acids, steroids, and drugs across epithelial cell membranes . This transporter is essential for intestinal basolateral bile acid export, impacting enterohepatic circulation and systemic bile acid homeostasis .

Key Features

  • Molecular Weight: ~28 kDa (predicted) .

  • Sequence: Includes critical transmembrane domains for bile acid binding and transport .

  • Purity: >85% (verified via SDS-PAGE) .

  • Storage: Stable for 6–12 months at -20°C/-80°C in lyophilized or liquid form with glycerol .

Functional Role

OSTA/OSTβ mediates bile acid efflux from enterocytes into portal blood, preventing intracellular bile acid accumulation and associated cytotoxicity . It preferentially transports conjugated primary bile acids like taurochenodeoxycholate (TCDCA) and glycochenodeoxycholate (GCDCA), which are linked to hepatotoxicity .

Production and Expression Systems

Recombinant Bovine OSTA is produced using multiple expression platforms:

Expression SystemSourceTagProduct Code
BaculovirusInsect cellsUndisclosedCSB-BP664892BO1
Mammalian cellsHEK293 or similarUndisclosedCSB-MP664892BO1
E. coliProkaryoticN-terminal HisMBS2123547

Notes:

  • Baculovirus systems yield higher post-translational modification fidelity .

  • E. coli-derived OSTA lacks mammalian glycosylation but offers cost efficiency .

Bile Acid Transport Studies

Recombinant Bovine OSTA is used to:

  • Characterize substrate specificity (e.g., GCDCA vs. TCA transport kinetics) .

  • Assess inhibition by xenobiotics (e.g., fidaxomicin IC~50~ = 59.8–210 µM for GCDCA/TCDCA) .

Drug-Induced Liver Injury (DILI)

OSTA inhibition by troglitazone sulfate and ethinyl estradiol correlates with cholestatic DILI risks, making it a biomarker for hepatotoxicity screening .

Genetic and Metabolic Disorders

Studies leverage recombinant OSTA to model mutations causing congenital diarrhea or cholestasis, as OSTα/β defects disrupt bile acid recycling .

  • Baculovirus/mammalian systems are preferred for structural studies due to native folding .

  • E. coli-expressed OSTA suits high-throughput inhibition assays .

Challenges and Future Directions

While Recombinant Bovine OSTA enables critical bile acid research, challenges include:

  • Stability: Repeated freeze-thaw cycles degrade activity; single-use aliquots are recommended .

  • Species Specificity: Bovine OSTA’s transport kinetics may differ from human orthologs, necessitating cross-validation .

Future studies may focus on cryo-EM structural resolution and in vivo delivery systems for therapeutic targeting of OSTα/β .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery estimates, kindly consult your local distributors.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type preference, please notify us, and we will prioritize its implementation.
Synonyms
SLC51A; OSTA; Organic solute transporter subunit alpha; OST-alpha; Solute carrier family 51 subunit alpha
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
SLC51A
Target Protein Sequence
MEPDRTQIRLDPRYTADLLEILKTNYSVPSACFSYPPTAAQLLRALGPVDISLMVIMTLF VLGSIAIFLEAAVYLHKNTRCPIKRKTLIWCSSSPTIVSAFSCFGLWIPRALTLVEMAIT TFYSMCFYLLMQAMVEGFGGKEAVLRTLKDTPVMIHTGPCCCCCPCCPRIKITRKRLQLL LLGPIQYAFFKISLTLVGLFLIPDGIFDPSDISEGSTALWINTFLGVSTLSALWTIGIIF RQARLHLGEQNIGAKFVLFQALLILSALQPSIFSVLASGGQIACSPPFSSKIRSQVMNCH LLILESFLITVLTRIYYRRKDDKLGYEPFSSPDQDLNLKA
Uniprot No.

Target Background

Function
Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that functions as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. It efficiently transports the major species of bile acids.
Database Links
Protein Families
OST-alpha family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of bovine Organic Solute Transporter Subunit Alpha (OSTA) and how does it compare to human OSTA?

Bovine OSTα is a transmembrane protein that functions in a heteromeric complex with OSTβ. The OSTα subunit is larger than OSTβ and is responsible for substrate recognition, while both subunits are required for proper membrane localization and transport function. The human OSTα gene (SLC51A) is located on chromosome 3q29 and can be transcribed into multiple splice variants (at least 14 documented variants) . While the specific bovine OSTα structure has fewer published characterizations, researchers should note that both OSTα and OSTβ subunits must be co-expressed to form a functional transporter complex on the basolateral plasma membrane of epithelial cells .

For experimental design, it's important to consider that:

  • The OSTα and OSTβ subunits stabilize each other in mammalian cells

  • When co-expressed, the protein complex has a half-life exceeding 24 hours

  • When OSTα is expressed alone, its half-life is reduced to approximately 2 hours

What are the primary substrates transported by bovine OSTA/OSTB complexes, and what experimental approaches can determine substrate specificity?

The bovine OSTα/β transporter facilitates the movement of bile acids (particularly taurocholate), steroid metabolites (including estrone sulfate), and various drugs across cell membranes . To determine substrate specificity in recombinant bovine OSTα/β systems, researchers should design uptake or efflux assays using radiolabeled or fluorescently tagged substrates in appropriate expression systems.

Methodologically, transport assays should include:

  • Cells expressing both OSTα and OSTβ subunits

  • Cells expressing individual subunits as negative controls

  • Substrate concentration gradients to determine kinetic parameters

  • Inhibitor studies to confirm transporter specificity

Previous studies have demonstrated increased uptake of taurocholate (TCA) and estrone sulfate (ES) in COS-7 cells co-expressing both OSTα and OSTβ compared to cells transfected with only one subunit .

How is bovine OSTA gene expression regulated in different experimental systems?

OSTα gene expression is tightly regulated by the nuclear receptor farnesoid X receptor (FXR), which responds to bile acid levels . For researchers working with bovine systems, it's crucial to understand this regulatory mechanism when designing experiments.

To effectively study bovine OSTα regulation:

  • Include FXR agonists (such as obeticholic acid) in experimental designs to observe upregulation

  • Consider the effect of cholestatic conditions which naturally increase OSTα expression

  • Monitor both mRNA and protein levels, as post-transcriptional regulation may occur

  • Account for tissue-specific regulatory mechanisms, particularly in intestinal and hepatic tissues

When designing cell culture systems for bovine OSTα studies, note that protein expression is significantly affected by co-expression with OSTβ, potentially through stabilization mechanisms .

What is the optimal expression system for recombinant bovine OSTA production?

When selecting an expression system for recombinant bovine OSTα, researchers should consider:

  • Mammalian expression systems (HEK293, MDCK cells) demonstrate proper membrane localization of OSTα only when co-expressed with OSTβ

  • Xenopus laevis oocytes allow individual expression of OSTα and OSTβ subunits at the plasma membrane, though functional transport requires both subunits

  • Cell lines with low endogenous expression of OSTα/β are preferable to minimize background

Methodologically, researchers should:

  • Use epitope tags that don't interfere with protein-protein interactions

  • Include proper controls for transfection efficiency

  • Verify plasma membrane localization using surface biotinylation or confocal microscopy

  • Confirm protein expression via Western blotting before functional assays

What tissue-specific expression patterns of OSTA should inform bovine recombinant protein research?

Bovine OSTα expression likely follows patterns similar to those documented in human tissues, with highest expression in the small intestine (particularly ileum and duodenum) . This tissue-specific expression pattern should inform both the design of recombinant expression systems and the physiological relevance of experimental findings.

The table below summarizes human OSTα/β tissue expression patterns that may guide bovine research:

TissueCell TypeOSTα LevelOSTβ Level
AppendixGlandular CellsMediumMedium
ColonGlandular CellsLowMedium
ColonPeripheral Nerve/GanglionLowNot detected
EpididymisGlandular CellsLowNot detected
KidneyCells in TubulesLowLow
LiverHepatocytesLowNot detected

Data derived from The Human Protein Atlas

These expression patterns highlight the importance of considering both subunits when designing recombinant systems, as natural expression levels of OSTα and OSTβ are not always equal.

What are the critical considerations when designing co-expression systems for recombinant bovine OSTA and OSTB?

When designing co-expression systems for recombinant bovine OSTα and OSTβ, researchers must address several critical factors:

  • Stoichiometry: While the exact OSTα/OSTβ stoichiometry remains unknown, evidence suggests variable ratios across different tissues . Experimental designs should test different expression ratios to optimize functional transport.

  • Vector selection: Consider using:

    • Bicistronic vectors for coordinated expression

    • Separate vectors with different selection markers to control expression ratios

    • Inducible expression systems to regulate protein levels

  • Verification methodology: Implement comprehensive verification protocols including:

    • Western blotting to confirm protein expression of both subunits

    • Immunofluorescence or surface biotinylation to verify plasma membrane localization

    • Transport assays with known substrates (taurocholate, estrone sulfate) to confirm functionality

  • Stability considerations: Research indicates that co-expression significantly enhances stability of both subunits, with the OSTα/β complex showing a half-life beyond 24 hours compared to approximately 2 hours for OSTα expressed alone .

How can researchers effectively measure transport activity of recombinant bovine OSTA/OSTB complexes?

To effectively measure transport activity of recombinant bovine OSTα/OSTβ complexes, researchers should implement multi-faceted approaches:

  • Substrate selection:

    • Primary bile acids (taurocholate, glycocholate)

    • Steroid conjugates (estrone sulfate)

    • Potential drug substrates of interest

  • Experimental systems:

    • Transfected cell lines (HEK293, MDCK, COS-7 cells have been successfully used)

    • Xenopus laevis oocyte expression systems

    • Vesicular transport assays using isolated membrane fractions

  • Analytical techniques:

    • Radiolabeled substrate tracking

    • Fluorescent substrate visualization

    • LC-MS/MS quantification for non-labeled substrates

  • Controls and validation:

    • Cells expressing individual subunits (non-functional)

    • Known inhibitors of OSTα/β transport

    • Concentration-dependent kinetics to determine Km and Vmax values

Previous studies using COS-7 cells demonstrated increased uptake of taurocholate and estrone sulfate only when both OSTα and OSTβ were co-expressed, providing a methodological framework for transport assays .

What analytical methods are most effective for studying bovine OSTA-OSTB protein interactions?

For analyzing bovine OSTα-OSTβ protein interactions, researchers should consider multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against one subunit to pull down the complex

    • Western blot analysis to detect the partner protein

    • Requires specific antibodies or epitope tags that don't interfere with protein interactions

  • Fluorescence resonance energy transfer (FRET):

    • Label OSTα and OSTβ with compatible fluorophores

    • Measure energy transfer as indication of protein proximity

    • Useful for live-cell dynamics of protein interaction

  • Bimolecular fluorescence complementation (BiFC):

    • Split fluorescent protein with segments fused to OSTα and OSTβ

    • Fluorescence occurs only upon interaction

    • Provides spatial information about interaction sites

  • Surface plasmon resonance (SPR):

    • Quantitative measurement of binding kinetics

    • Requires purified protein components

    • Determines association and dissociation constants

  • Crosslinking studies:

    • Chemical crosslinkers to stabilize protein complexes

    • Mass spectrometry to identify interaction sites

    • Provides structural information about the interface

The evidence that OSTα and OSTβ stabilize each other in mammalian cells suggests strong protein-protein interactions that should be detectable by these methods.

How can researchers differentiate between the effects of OSTA alone versus the OSTA/OSTB complex in functional studies?

Differentiating between effects of OSTα alone versus the OSTα/OSTβ complex requires careful experimental design:

  • Expression system controls:

    • Cells expressing OSTα only

    • Cells expressing OSTβ only

    • Cells expressing both subunits

    • Empty vector controls

  • Membrane localization analysis:

    • Surface biotinylation to quantify membrane-localized protein

    • Confocal microscopy with membrane markers

    • Subcellular fractionation with Western blotting

  • Functional assays:

    • Transport studies with known substrates (taurocholate, estrone sulfate)

    • Comparison of transport kinetics between systems

    • Inhibitor sensitivity profiles

  • Protein stability measurements:

    • Cycloheximide chase experiments to measure half-life

    • Pulse-chase labeling to track protein fate

    • Quantitative Western blotting at multiple time points

Previous research demonstrates that in mammalian cells (HEK293, MDCK), both subunits must be co-expressed for proper membrane localization, while in Xenopus oocytes, individual subunits can reach the plasma membrane but lack transport function . These systems provide excellent models for differentiation studies.

What approaches can identify novel substrates or inhibitors of bovine OSTA/OSTB transporters?

To identify novel substrates or inhibitors of bovine OSTα/OSTβ transporters, researchers should implement systematic screening approaches:

  • High-throughput transport assays:

    • Fluorescent substrate accumulation in cells expressing OSTα/OSTβ

    • Competition assays with known substrates

    • Membrane vesicle uptake assays with candidate compounds

  • Structure-activity relationship studies:

    • Test compounds with structural similarity to known substrates

    • Molecular modeling based on substrate characteristics

    • Rational design of potential inhibitors

  • Drug library screening:

    • Test FDA-approved drug libraries for inhibitory effects

    • Focus on compounds associated with hepatotoxicity, as some drugs associated with liver injury inhibit OSTα/OSTβ

    • Analyze bile acid-related compounds as potential substrates

  • Validation methodologies:

    • Concentration-dependent inhibition studies

    • Direct transport measurements with radiolabeled candidate substrates

    • Bidirectional transport studies (apical-to-basolateral and basolateral-to-apical)

  • Genetic approaches:

    • Site-directed mutagenesis to identify substrate binding sites

    • Chimeric transporters to determine substrate specificity domains

    • Computational prediction of binding sites followed by experimental validation

How is OSTA expression altered in liver disease models and what are the implications for research using recombinant bovine OSTA?

OSTα expression undergoes significant changes in various liver disease states, with important implications for researchers using recombinant bovine OSTα:

  • Upregulation patterns:

    • Markedly increased in extrahepatic cholestasis

    • Significantly elevated in obstructive cholestasis

    • Upregulated in primary biliary cholangitis (PBC)

    • Highly upregulated in nonalcoholic steatohepatitis (NASH)

  • Mechanistic considerations:

    • Upregulation appears to be an adaptive response to elevated bile acid levels

    • Mediated primarily through FXR activation

    • May serve as a compensatory mechanism to reduce hepatic bile acid accumulation

  • Research applications:

    • Recombinant bovine OSTα can serve as a model system to study these adaptive responses

    • Disease-specific modifications may alter transport kinetics or substrate specificity

    • Post-translational modifications in disease states might affect protein-protein interactions

  • Experimental implications:

    • Cell culture models should include conditions that mimic disease states (elevated bile acids, inflammatory mediators)

    • Consider using FXR agonists to simulate disease-induced upregulation

    • Compare native versus recombinant systems to validate physiological relevance

These disease-related alterations highlight the importance of contextualizing recombinant bovine OSTα research within physiological and pathophysiological frameworks .

What role does bovine OSTA play in bile acid homeostasis and how can recombinant systems model this function?

Bovine OSTα, similar to its human counterpart, plays a critical role in bile acid homeostasis, particularly in the enterohepatic circulation:

  • Physiological function:

    • Located on the basolateral membrane of intestinal epithelial cells

    • Works in concert with apical ASBT (SLC10A2) to facilitate bile acid absorption

    • Essential for the reabsorption and enterohepatic circulation of bile acids

    • Protects ileal epithelium against intracellular bile acid accumulation and intestinal injury

  • Recombinant system design considerations:

    • Polarized cell models (Caco-2, MDCK) that allow for apical vs. basolateral transport studies

    • Co-expression with other relevant transporters (ASBT) to model complete transport systems

    • Incorporation of FXR-responsive elements to recapitulate regulatory mechanisms

  • Experimental approaches:

    • Bidirectional transport studies in transwells

    • Intracellular bile acid accumulation measurements

    • Cytotoxicity assays to assess protective effects against bile acid-induced injury

    • Co-culture systems that model enterohepatic circulation

  • Validation methods:

    • Comparison with primary bovine intestinal cells

    • Correlation with in vivo bile acid kinetics

    • Functional assessment under physiological and pathological bile acid concentrations

Researchers developing recombinant bovine OSTα systems should note that OSTα/β-mediated efflux of bile acids protects the ileal epithelium against intracellular bile acid accumulation and intestinal injury in mice , suggesting similar protective functions in bovine systems.

How can recombinant bovine OSTA be utilized to study drug-drug interactions and drug-induced liver injury (DILI)?

Recombinant bovine OSTα systems offer valuable platforms for studying drug-drug interactions and drug-induced liver injury mechanisms:

  • Drug-drug interaction studies:

    • Competition assays between drugs and endogenous substrates

    • Inhibition kinetics and IC50 determination

    • Bidirectional transport assessments to identify direction-specific interactions

    • Combination studies to identify synergistic or antagonistic effects

  • DILI investigation applications:

    • Screening of hepatotoxic drugs for OSTα/β inhibition, as some drugs associated with hepatotoxicity inhibit OSTα/β

    • Assessment of intracellular bile acid accumulation as a mechanism of toxicity

    • Correlation between OSTα/β inhibition potency and clinical DILI risk

    • Identification of structural features associated with OSTα/β inhibition

  • Experimental design considerations:

    • Concentration ranges should span therapeutic to toxic levels

    • Include positive controls (known OSTα/β inhibitors)

    • Consider species differences when extrapolating to human risk

    • Assess both acute and chronic exposure effects

  • Analytical approaches:

    • LC-MS/MS quantification of intracellular drug and bile acid concentrations

    • Real-time monitoring of transport activity

    • Cytotoxicity assays correlated with transport inhibition

    • Transcriptomic analysis of compensatory responses

The International Transporter Consortium has acknowledged the potential importance of OSTα/β-mediated drug interactions , highlighting the relevance of these studies for drug development and safety assessment.

What genetic variations in OSTA have been documented and how might they impact recombinant protein function?

Genetic variations in OSTα have significant implications for recombinant protein research:

  • Clinical significance:

    • Homozygous genetic defects in both OSTα/β subunits have been reported in humans, resulting in diarrhea and features of cholestasis

    • These cases demonstrate the clinical consequences of OSTα/β dysfunction

  • Research applications:

    • Introduction of identified mutations into recombinant bovine OSTα

    • Structure-function studies to determine critical protein domains

    • Assessment of mutation effects on protein stability, localization, and function

    • Drug rescue studies to identify compounds that might restore function to mutant proteins

  • Experimental approaches:

    • Site-directed mutagenesis to introduce specific variants

    • CRISPR-Cas9 gene editing in cell models

    • Protein trafficking analysis of mutant forms

    • Transport kinetics comparison between wild-type and variant proteins

  • Splice variant considerations:

    • Human SLC51A has 14 documented splice variants

    • Differential expression of these variants across tissues may indicate tissue-specific functions

    • Recombinant systems should consider which splice variant is most relevant to the research question

The existence of multiple splice variants of human SLC51A (at least 14 documented variants) suggests potential functional diversity that should be explored in bovine systems as well.

How might recombinant bovine OSTA systems contribute to understanding and treating metabolic disorders?

Recombinant bovine OSTα systems offer valuable tools for metabolic disorder research:

  • NASH and obesity investigations:

    • OSTα/β is highly upregulated in patients with NASH

    • The incidence of NASH is increasing with the obesity epidemic

    • Recombinant systems can model the impact of this upregulation on bile acid homeostasis

    • Mechanistic studies to determine if OSTα/β upregulation is protective or pathogenic

  • Diabetes research applications:

    • OSTα/β is linked to bile acid-related metabolic disorders including diabetes

    • Recombinant systems can explore interactions with anti-diabetic drugs

    • Assessment of how insulin resistance affects OSTα/β function

    • Investigation of bile acid signaling pathways in metabolic regulation

  • Therapeutic development platforms:

    • OSTα/β is a potential drug target for treatment of cholestatic liver disease and other bile acid-related metabolic disorders

    • High-throughput screening for OSTα/β modulators

    • Structure-based drug design targeting the OSTα/β interface

    • Validation of hit compounds in recombinant versus native systems

  • Experimental approaches:

    • Lipid loading models to simulate NASH conditions

    • Insulin resistance models to mimic diabetic states

    • Co-culture systems with adipocytes and hepatocytes

    • Integration with nuclear receptor signaling pathways (particularly FXR)

The close regulation of OSTα/β by FXR, a key metabolic regulator, positions this transporter at the intersection of bile acid homeostasis and metabolic control , making recombinant systems particularly valuable for understanding these complex relationships.

What are the most promising therapeutic approaches targeting OSTA/OSTB, and how can recombinant bovine systems facilitate their development?

Therapeutic approaches targeting OSTα/OSTβ represent an emerging frontier with several promising directions:

The potential of OSTα/β as a therapeutic target is highlighted by its role in bile acid homeostasis and its upregulation in multiple disease states , positioning recombinant systems as valuable tools in this developing field.

How do post-translational modifications affect bovine OSTA function, and what methodologies can characterize these modifications?

Post-translational modifications (PTMs) of bovine OSTα likely play crucial roles in regulating its function:

  • Potential PTMs affecting OSTα function:

    • Phosphorylation: May regulate transport activity or protein-protein interactions

    • Glycosylation: Could affect protein stability and trafficking

    • Ubiquitination: Likely involved in protein turnover regulation

    • SUMOylation: Potentially regulating nuclear localization or protein complexes

  • Methodological approaches for PTM characterization:

    • Mass spectrometry-based proteomics for comprehensive PTM identification

    • Site-directed mutagenesis of potential modification sites

    • Phospho-specific antibodies for phosphorylation detection

    • Click chemistry approaches for glycosylation analysis

    • Protein stability assays following PTM inhibitor treatment

  • Functional impact assessment:

    • Comparison of transport kinetics between modified and unmodified proteins

    • Trafficking studies using fluorescently tagged wild-type versus PTM-deficient mutants

    • Protein half-life determination under various cellular conditions

    • Co-immunoprecipitation to assess effects on protein-protein interactions

  • Physiological and pathological relevance:

    • Investigation of PTM changes in disease models

    • Analysis of PTM status during adaptive responses to bile acid loading

    • Exploration of species-specific PTM patterns between bovine and human OSTα

The extended half-life of OSTα when co-expressed with OSTβ suggests post-translational stabilization mechanisms that warrant detailed investigation.

What are the comparative differences between bovine and human OSTA that researchers should consider when using bovine models?

When using bovine OSTα as a model for human applications, researchers should consider several key comparative aspects:

  • Sequence and structural considerations:

    • Amino acid sequence homology between species

    • Conservation of critical functional domains

    • Differences in potential post-translational modification sites

    • Species-specific splice variants (human SLC51A has 14 documented splice variants)

  • Functional comparisons:

    • Substrate specificity profiles

    • Transport kinetics for key substrates

    • Inhibitor sensitivity patterns

    • Regulatory mechanisms and promoter elements

  • Expression pattern differences:

    • Tissue-specific expression levels

    • Cellular localization patterns

    • Developmental expression timing

    • Disease-associated expression changes

  • Experimental design implications:

    • Use multiple model systems to validate findings

    • Direct comparison studies between bovine and human recombinant proteins

    • Careful extrapolation of drug interaction data between species

    • Consideration of physiological differences in bile acid composition and pool size

  • Technical approaches for comparative studies:

    • Chimeric proteins to identify species-specific functional domains

    • Parallel screening assays with both species' proteins

    • Computational modeling of structural differences

    • Cross-species validation of regulatory mechanisms

Understanding these comparative differences is essential for translating findings from bovine models to human applications and for developing species-specific therapeutic approaches.

What emerging technologies are most promising for advancing research on recombinant bovine OSTA?

Several cutting-edge technologies hold particular promise for advancing recombinant bovine OSTα research:

  • Structural biology approaches:

    • Cryo-electron microscopy for detailed structural analysis of the OSTα/OSTβ complex

    • HDX-MS (hydrogen-deuterium exchange mass spectrometry) to study conformational dynamics

    • Computational modeling and molecular dynamics simulations

    • Single-particle analysis of transporters in native-like environments

  • Advanced genetic engineering technologies:

    • CRISPR-Cas9 for precise genome editing in bovine systems

    • Base editing for introducing specific point mutations

    • Inducible expression systems with fine-tuned control

    • Knock-in reporter systems for real-time monitoring

  • High-resolution imaging techniques:

    • Super-resolution microscopy for detailed localization studies

    • Live-cell imaging to track protein trafficking and interactions

    • Correlative light and electron microscopy

    • Label-free imaging methods for native protein visualization

  • Single-cell and organoid technologies:

    • Single-cell transcriptomics to study heterogeneity in OSTα expression

    • Liver and intestinal organoids for physiologically relevant models

    • Microfluidic systems for transport studies under flow conditions

    • Organ-on-chip models incorporating multiple cell types

  • High-throughput functional assays:

    • FACS-based sorting for functional variants

    • Droplet microfluidics for single-cell transport studies

    • Automated patch-clamp for electrophysiological measurements

    • Multiplexed substrate screening platforms

These technologies could help address key knowledge gaps, particularly regarding the structure and stoichiometry of the OSTα/OSTβ complex, which remains incompletely understood .

How can systems biology approaches integrate recombinant bovine OSTA research into broader metabolic pathway studies?

Systems biology approaches offer powerful frameworks for integrating recombinant bovine OSTα research into comprehensive metabolic studies:

  • Multi-omics integration strategies:

    • Combination of transcriptomics, proteomics, and metabolomics data

    • Integration of OSTα/β expression data with bile acid metabolite profiles

    • Correlation analysis between transporter expression and downstream metabolic effects

    • Network analysis to identify key regulatory nodes

  • Computational modeling approaches:

    • Physiologically-based pharmacokinetic (PBPK) modeling incorporating OSTα/β transport

    • Genome-scale metabolic models including bile acid homeostasis

    • Agent-based models of enterohepatic circulation

    • Machine learning approaches to predict OSTα/β substrates and inhibitors

  • Experimental systems for integrated studies:

    • Co-culture systems modeling multiple tissues (liver-intestine-kidney)

    • Metabolic flux analysis using stable isotope-labeled bile acids

    • Perturbation studies with simultaneous monitoring of multiple pathways

    • Temporal studies capturing dynamic responses to OSTα/β modulation

  • Disease-focused applications:

    • Integration of OSTα/β function into NASH pathogenesis models

    • Systems-level analysis of adaptive responses in cholestatic conditions

    • Metabolic network perturbations in OSTα/β genetic variants

    • Host-microbiome interactions in bile acid metabolism

The role of OSTα/β in bile acid homeostasis and its connections to metabolic disorders such as NASH, obesity, and diabetes make it particularly amenable to systems biology approaches that can capture these complex interrelationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.