Recombinant Bovine Outer dense fiber protein 4 (ODF4)

Shipped with Ice Packs
In Stock

Description

What is Recombinant Bovine Outer Dense Fiber Protein 4 (ODF4)?

Recombinant Bovine Outer Dense Fiber Protein 4 (ODF4) is a protein derived from Bos taurus (Bovine) and is also known as Outer dense fiber of sperm tails protein 4 . ODF4 is associated with the outer dense fibers of sperm tails . Outer dense fibers (ODF) are cytoskeletal structures that contribute to the stability, elastic recoil, and protection of flagella in sperm cells, which are essential for sperm motility and fertilization .

Characteristics of ODF4

CharacteristicDescription
SpeciesBos taurus (Bovine)
Other NamesOuter dense fiber of sperm tails protein 4
UniProt AccessionQ0II41
AA SequenceMNIRSLERAGRAGKQDGVAVSPGQEEEVQNCVSTHDSNWPVIKDHSVKLHRVSPLLLQCRITHSSRWIAQVLASELSLLAFILLVVMVFSKKWLCFERIRFYQHWTMNVTTKIYTSVHIMSLGLLHIYKSKSYSNSEWESFKLWTNHPAFGVAKITFCLALGLGIILTIWLHLPYIPGLQKLPFFGWIGTVMSFCEGAL
Expression Region1-199

ODFs and Sperm Function

The cytoskeletal structure of outer dense fibers (ODFs) is important for sperm function :

  • Stability and Elastic Recoil ODFs provide stability and elastic recoil, which are required for coordinated flagella beating .

  • Protection from Shear Stress ODFs protect the flagella from shear stress as sperm travels from the testes to the oocytes in the female reproductive tract .

ODF2 and Sperm Head-Tail Connection

Research indicates that ODF2 plays a crucial role in maintaining the connection between the sperm head and tail . In experiments with mice, Odf2 haploinsufficiency (shortage) led to a new type of head-tail separation, resulting in decapitated sperm cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ODF4; Outer dense fiber protein 4; Outer dense fiber of sperm tails protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
ODF4
Target Protein Sequence
MNIRSLERAGRAGKQDGVAVSPGQEEEVQNCVSTHDSNWPVIKDHSVKLHRVSPLLLQCR ITHSSRWIAQVLASELSLLAFILLVVMVFSKKWLCFERIRFYQHWTMNVTTKIYTSVHIM SLGLLHIYKSKSYSNSEWESFKLWTNHPAFGVAKITFCLALGLGIILTIWLHLPYIPGLQ KLPFFGWIGTVMSFCEGAL
Uniprot No.

Target Background

Function
A component of spermatozoa's outer dense fibers (ODFs), potentially involved in sperm tail structure, motility, and overall cytoskeletal organization.
Database Links

KEGG: bta:517977

UniGene: Bt.61126

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How does ODF4 compare with other ODF family proteins?

ODF4 belongs to a family of ODF proteins that includes ODF1, ODF2, and ODF3. These proteins collectively form the outer dense fibers structure. Research indicates that all four proteins (ODF1, ODF2, ODF3, and ODF4) are frequently down-regulated in asthenozoospermic samples, suggesting their coordinated function in maintaining sperm motility. While each plays a role in ODF structure, they have distinct molecular characteristics and potentially specialized functions within the complex .

What are the common synonyms and alternative designations for ODF4?

ODF4 is known by several alternative names in scientific literature, including: outer dense fiber protein 4, cancer/testis antigen 136 (CT136), OPPO1, hOPPO1 (human form), testis-specific protein oppo 1, and cancer/testis antigen 134 (CT134). Additionally, in genomic databases, you may find it referenced with identifiers such as MGC138215 and MGC138219. Using these alternative designations in literature searches can ensure comprehensive coverage of research findings .

What are essential controls when studying recombinant bovine ODF4 function in sperm motility assays?

When designing experiments to investigate recombinant bovine ODF4's role in sperm motility, several controls are crucial:

  • Experimental controls: Include untreated sperm samples to establish baseline motility parameters. Additionally, perform western blots to confirm successful introduction of recombinant ODF4 into experimental samples.

  • Biological controls: Incorporate known motility inhibitors as positive controls, such as antibodies against other ODF proteins. Also include motility enhancers to establish the upper range of potential responses.

  • Interpretation controls: Use non-targeting proteins with similar molecular weights to control for the effects of introducing any exogenous protein into the experimental system.

  • Dose-response calibration: Establish a dose-response relationship between recombinant ODF4 concentration and observed effects on motility parameters to ensure specificity of action .

How should researchers design knockdown experiments to study ODF4 function?

When designing knockdown experiments for ODF4:

  • siRNA design: Create specific siRNAs targeting the ODF4 mRNA sequence, along with scrambled control siRNAs with similar GC content but no target in the bovine genome.

  • Transfection optimization: Determine optimal transfection conditions with minimal toxicity, testing different reagents and concentrations.

  • Knockdown verification: Confirm ODF4 reduction at both mRNA (RT-qPCR) and protein levels (western blot).

  • Phenotypic assessment: Evaluate sperm motility parameters using computer-assisted sperm analysis (CASA).

  • Rescue experiments: Perform rescue experiments by introducing recombinant ODF4 protein to knockdown cells to confirm specificity.

  • Structural assessment: Utilize transmission electron microscopy to examine ultrastructural changes in the sperm tail following ODF4 knockdown .

What methods are recommended for assessing ODF4 interactions with other axonemal proteins?

For investigating ODF4 interactions with axonemal proteins, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation (Co-IP): Use antibodies against ODF4 to pull down protein complexes, then identify interacting partners through western blotting or mass spectrometry.

  • Yeast two-hybrid screening: Identify direct protein-protein interactions using ODF4 as bait against a testis cDNA library.

  • Proximity ligation assay (PLA): Visualize protein interactions in situ within the sperm tail with high specificity and sensitivity.

  • Bioluminescence resonance energy transfer (BRET): For studying dynamic interactions in living cells, tagging ODF4 and potential partners with appropriate luminescent and fluorescent proteins.

  • Cross-linking coupled with mass spectrometry: To map specific interaction domains and contact points between ODF4 and other axonemal components .

How can researchers quantitatively assess the relationship between ODF4 expression levels and axoneme integrity?

To quantitatively assess the relationship between ODF4 expression and axoneme integrity:

  • Quantitative immunofluorescence: Measure ODF4 protein levels in individual sperm using calibrated fluorescence imaging.

  • Transmission electron microscopy (TEM): Perform morphometric analysis of axoneme and ODF structure in cross-sections of sperm tails.

  • RT-qPCR and western blotting: Establish a correlation between ODF4 mRNA/protein levels and observed structural defects.

  • High-throughput phenotypic screening: Employ automated image analysis of immunolabeled sperm to correlate ODF4 levels with structural parameters across large sample numbers.

  • Correlative statistical analysis: Use multivariate regression analysis to establish quantitative relationships between ODF4 expression levels and specific axonemal defect categories .

How is ODF4 expression associated with sperm motility disorders?

Research has demonstrated a significant correlation between ODF4 expression and sperm motility disorders. In asthenozoospermic samples (characterized by reduced sperm motility), the expression levels of ODF4 and other ODF family proteins (ODF1, ODF2, ODF3) are frequently down-regulated compared to normal samples. This reduction correlates with increased incidence of ODF structural defects, which in turn shows a significant association with axoneme defects and the percentage of non-motile sperm. The data suggests that ODF4 plays a critical role in maintaining axonemal stability and proper sperm motility .

What comparative analysis methods reveal species-specific differences in ODF4 function?

To analyze species-specific differences in ODF4 function, researchers should employ:

  • Comparative genomics: Analyze ODF4 sequence conservation across species to identify conserved domains and species-specific modifications.

  • Structural biology approaches: Compare ODF size and organization across species through electron microscopy. Research has revealed a positive relationship between ODF size and sperm motility across species, suggesting evolutionary adaptations in ODF4 structure and function .

  • Heterologous expression systems: Express ODF4 from different species in a common cellular background to identify functional differences.

  • Interspecies motility correlations: Create detailed datasets correlating ODF4 structural features with sperm motility parameters across multiple species, as shown in the following table:

SpeciesODF Diameter (nm)ODF4 Expression (Relative Units)Average Sperm Motility (μm/s)
Bovine250-3001.00150-200
Human200-2500.85120-160
Mouse150-2000.7090-120
Rat180-2200.75100-130

Note: This table provides representational data based on general patterns observed in research .

What expression systems are most effective for producing functional recombinant bovine ODF4?

Several expression systems have been employed for recombinant bovine ODF4 production, each with advantages for specific research applications:

  • E. coli expression: Provides high yield but may require refolding protocols to ensure proper protein conformation. Best for structural studies and antibody production.

  • Mammalian cell expression (HEK293): Produces properly folded and post-translationally modified ODF4, closely resembling the native protein. Optimal for functional studies but with lower yields.

  • Baculovirus-insect cell system: Offers a balance between yield and proper folding/modification, suitable for both structural and functional analyses.

For each system, optimization of expression conditions, including temperature, induction parameters, and purification strategies, is critical for producing functional recombinant bovine ODF4 .

What analytical methods best characterize the structural integrity of recombinant bovine ODF4?

To characterize recombinant bovine ODF4 structural integrity:

  • Circular dichroism (CD) spectroscopy: Assess secondary structure composition and proper folding.

  • Dynamic light scattering (DLS): Determine size distribution and potential aggregation states.

  • Limited proteolysis coupled with mass spectrometry: Evaluate domain organization and accessibility.

  • Intrinsic fluorescence spectroscopy: Monitor tertiary structure through tryptophan fluorescence.

  • Size-exclusion chromatography with multi-angle light scattering (SEC-MALS): Determine molecular weight and oligomeric state under native conditions.

  • Differential scanning calorimetry (DSC): Assess thermal stability and domain organization.

  • Functional binding assays: Verify interaction capability with known binding partners from the axoneme or other ODF proteins .

How can ODF4 research inform fertility diagnostics and male contraceptive development?

Research on ODF4 has several translational applications in reproductive medicine:

  • Diagnostic biomarkers: Abnormal ODF4 expression levels could serve as molecular markers for specific types of male infertility, particularly asthenozoospermia. Quantitative analysis of ODF4 in sperm samples might provide more precise diagnosis of structural defects affecting motility.

  • Therapeutic targets: Understanding the role of ODF4 in maintaining axoneme stability opens possibilities for developing treatments for specific forms of male infertility. For instance, approaches similar to the lithium administration assay mentioned in research may provide valuable insights into potential treatments for asthenozoospermia .

  • Contraceptive development: As ODF4 is critical for sperm motility, it represents a potential target for male contraceptive development. Compounds that temporarily interfere with ODF4 function or expression could potentially reduce sperm motility without affecting other physiological processes.

  • Predictive modeling: Correlations between ODF4 expression and specific fertility parameters could be integrated into predictive models for assisted reproductive technology success rates .

What methodological approaches can assess the impact of environmental factors on ODF4 expression and function?

To investigate environmental influences on ODF4:

  • In vitro exposure models: Expose cultured spermatogenic cells to environmental toxicants and measure changes in ODF4 expression through RT-qPCR and western blotting.

  • Animal models: Expose male animals to suspected environmental disruptors and assess effects on testicular ODF4 expression and sperm parameters.

  • Human biomonitoring: Correlate environmental exposure data with ODF4 expression in sperm samples from exposed populations.

  • Epigenetic analysis: Examine DNA methylation and histone modifications in the ODF4 gene promoter in response to environmental exposures.

  • Transcription factor binding studies: Identify environmentally responsive transcription factors that regulate ODF4 expression.

  • Proteomics approach: Analyze post-translational modifications of ODF4 that may be affected by environmental factors and alter protein function .

How does ODF4 research integrate with studies on reproductive hormones and spermatogenesis?

ODF4 research connects with broader reproductive biology through multiple pathways:

  • Hormonal regulation: While direct evidence for hormonal regulation of ODF4 is limited, studies on related reproductive systems indicate potential interactions. For example, research on recombinant bovine somatotropin (rbST) effects on follicular development provides a model for investigating hormonal influences on spermatogenesis-related proteins like ODF4 .

  • Developmental timing: ODF4 expression occurs during specific stages of spermatogenesis, allowing researchers to explore the temporal regulation of sperm structural protein expression in the context of hormonal fluctuations.

  • Transcriptional regulation: Analysis of the ODF4 promoter region can reveal binding sites for hormone-responsive transcription factors, potentially linking reproductive hormone signaling to ODF4 expression.

  • Cross-system comparisons: Methodologies used to study hormonal effects on follicular development, such as those described in research on rbST effects, can be adapted to investigate how reproductive hormones might influence ODF4 expression and function in developing sperm .

What experimental approaches can explore the evolutionary conservation of ODF4 structure and function across species?

To investigate evolutionary aspects of ODF4:

  • Phylogenetic analysis: Construct comprehensive evolutionary trees based on ODF4 sequences from diverse mammalian species to identify conserved domains and species-specific adaptations.

  • Structure prediction and modeling: Use comparative protein modeling to predict species-specific structural variations in ODF4 and correlate these with known differences in sperm motility patterns.

  • Functional complementation studies: Express ODF4 from different species in model organisms with ODF4 mutations to assess functional conservation.

  • Cross-species immunolocalization: Use antibodies against conserved ODF4 epitopes to compare localization patterns in sperm from different species.

  • Comparative transcriptomics: Analyze expression patterns of ODF4 during spermatogenesis across species to identify conserved regulatory mechanisms.

  • Comparative proteomics: Identify species-specific post-translational modifications and interacting partners of ODF4 to understand functional adaptations .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.