Recombinant Bovine Oxidized low-density lipoprotein receptor 1 (OLR1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bovine Oxidized Low-Density Lipoprotein Receptor 1 (OLR1), also known as LOX-1, is a genetically engineered protein expressed in E. coli systems. This receptor plays a critical role in binding, internalizing, and degrading oxidized low-density lipoprotein (oxLDL), a key contributor to atherosclerosis and vascular endothelial dysfunction . Its recombinant form enables researchers to study its structural, functional, and pathological roles in lipid metabolism, cardiovascular diseases, and cellular homeostasis .

Role in Atherosclerosis and Lipid Metabolism

  • Binds oxLDL, facilitating its uptake by vascular endothelial cells, which drives foam cell formation and atherosclerotic plaque development .

  • Upregulated under pro-atherogenic conditions (e.g., hypertension, diabetes) .

  • Mediates endothelial cell activation, apoptosis, and inflammation .

Clearance of Apoptotic Cells

  • Recognizes phosphatidylserine (PS) on apoptotic cells, promoting their phagocytosis and maintaining vascular homeostasis .

  • Competitively inhibited by oxLDL, acetyl LDL, and fucoidan .

Genetic Polymorphisms and Economic Traits

Single nucleotide polymorphisms (SNPs) in bovine OLR1 correlate with economically significant traits:

Table 1: Key SNPs and Associated Traits in Cattle

SNPLocationAssociated TraitImpact
g.8232C>A3′ UTRMilk fat percentageIncreased fat yield in Holstein cattle
T10588C3′ UTRBackfat thickness, intramuscular fatTT genotype linked to higher fat content
C10647T3′ UTRBackfat thickness, intramuscular fatTT genotype enhances fat deposition
c.-495T>CPromoter regionRib-eye area in Angus cattleInfluences muscle development

Key Insights:

  • The 3′ UTR SNPs (e.g., T10588C, C10647T) alter miRNA binding sites (e.g., bta-miR-12047, bta-miR-12021), potentially modulating OLR1 expression and lipid metabolism .

  • Haplotype Hap3 (-G1T2C3-) occurs at 42.1% frequency in Qinchuan cattle and correlates with superior carcass quality .

Expression and Functional Studies

  • Recombinant OLR1 inhibits interactions between oxLDL and endothelial cells, highlighting its therapeutic potential .

  • Macrophage differentiation upregulates LOX-1, enhancing oxLDL uptake and foam cell formation .

Applications in Biomedical Research

  1. Atherosclerosis Models: Used to study oxLDL-induced endothelial dysfunction and plaque formation .

  2. Therapeutic Target Exploration: Blocking LOX-1 with monoclonal antibodies or soluble receptors reduces oxLDL uptake .

  3. Disease Biomarker: Elevated OLR1 levels in serum correlate with cardiovascular disease progression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
OLR1; LOX1; Oxidized low-density lipoprotein receptor 1; Ox-LDL receptor 1; Lectin-like oxidized LDL receptor 1; LOX-1; Lectin-like oxLDL receptor 1; bLOX-1; Lectin-type oxidized LDL receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MTVDDPKGMKDQLDQKPNGKTAKGFVSSWRWYPAAVTLGVLCLGLLVTVILLILQLSQVSDLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLAHKLDEKSKKLMELHRQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGSFNWEKSQENCLSLDAHLLKINSTDELEFIQQMIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCAYIQRGTVFAENCILTAFSICQKKANLLRAQ
Uniprot No.

Target Background

Function
Recombinant Bovine Oxidized low-density lipoprotein receptor 1 (OLR1) is a receptor mediating the recognition, internalization, and degradation of oxidized low-density lipoprotein (oxLDL) by vascular endothelial cells. OxLDL, an atherosclerosis marker, induces endothelial cell activation and dysfunction, leading to pro-inflammatory responses, oxidative stress, and apoptosis. OLR1's oxLDL interaction activates NF-κB via increased reactive oxygen species production, triggering pro-atherogenic responses, including reduced nitric oxide (NO) release, monocyte adhesion, and apoptosis. Beyond oxLDL binding, OLR1 functions as a receptor for HSP70, crucial for antigen cross-presentation to naïve T-cells in dendritic cells, thereby participating in cell-mediated antigen presentation. Furthermore, it plays a role in inflammation by acting as a leukocyte-adhesion molecule at the vascular interface during endotoxin-induced inflammation. OLR1 also acts as a receptor for advanced glycation end (AGE) products, activated platelets, monocytes, apoptotic cells, and both Gram-negative and Gram-positive bacteria.
Gene References Into Functions
  1. Endothelial LOX-1 overexpression in atherosclerosis-prone LDL receptor knockout mice impairs endothelial function, highlighting its role in atherosclerosis development. PMID: 29096854
  2. bta-miR-370 negatively regulates the OLR1 gene at both transcriptional and translational levels, influencing lipid metabolism in bovine adipocytes. PMID: 28294375
  3. LOX-1 overexpression attenuates protective autophagy in aortic endothelial cells. PMID: 25703423
  4. The 3' UTR SNP of the OLR1 gene is a potential marker for cattle breeding selection. PMID: 23910552
  5. Inhibition of the LOX-1 receptor signaling pathway may improve steroid hormone concentrations in metabolically active females. PMID: 24115745
  6. LOX-1 inhibition redistributes ceramide from the basal membrane to the Golgi apparatus. PMID: 24710763
  7. ox-LDL-induced eNOS downregulation, mediated by LOX-1-driven endoplasmic stress, involves the PI3K-Akt-eNOS pathway. PMID: 24085225
  8. 3'-UTR SNP is associated with milk composition traits and somatic cell score. PMID: 22365237
  9. Disrupted lipid packing in cholesterol-rich membrane domains contributes to oxLDL-induced changes in endothelial biomechanics. PMID: 20410437
  10. OLR1 single nucleotide polymorphism haplotype is associated with milk fat yield and percentage. PMID: 16606746
  11. Cyclic tensile stretch and ox-LDL synergistically affect chondrocyte viability and proteoglycan synthesis, possibly via enhanced LOX-1 expression. PMID: 16795046
  12. LOX-1 upregulates VEGF expression in articular cartilage, partially through PPAR-γ activation. PMID: 16904074
  13. LOX-1 mediates electronegative low-density lipoprotein signaling, potentially contributing to endothelial apoptosis. PMID: 19150883
  14. ox-LDL binding to LOX-1 induces stress-induced senescence and telomerase suppression in chondrocytes, suggesting a role in osteoarthritis pathogenesis. PMID: 19790061
Database Links

KEGG: bta:281368

STRING: 9913.ENSBTAP00000005975

UniGene: Bt.367

Subcellular Location
Cell membrane; Lipid-anchor. Cell membrane; Single-pass type II membrane protein. Membrane raft. Secreted.
Tissue Specificity
Highly expressed in endothelial cells, aortic intima and lung. Expressed at low level in other tissues.

Q&A

What is the genomic structure and chromosomal location of bovine OLR1?

The bovine OLR1 gene is located on chromosome 18 and comprises 6 exons and 5 introns spanning approximately 7-kb of genomic DNA . The gene structure is conserved between species, with similar exon-intron organization observed in human OLR1, although with some variation in intron sizes. Researchers should note that a complete understanding of the promoter region is essential for expression studies, as regulatory elements may influence tissue-specific expression patterns.

What are the primary tissue expression patterns of bovine OLR1?

Bovine OLR1 exhibits high expression levels primarily in lung, liver, and adipose tissue . This tissue-specific expression pattern reflects its functional roles in lipid metabolism. When designing experiments involving recombinant OLR1, researchers should consider these natural expression patterns to establish physiologically relevant experimental conditions. Expression levels may vary with developmental stage and physiological conditions, which should be accounted for in experimental design.

How does bovine OLR1 function at the molecular level?

At the molecular level, bovine OLR1 functions as a cell surface receptor that recognizes and facilitates the internalization and degradation of oxidized low-density lipoprotein (ox-LDL). The protein is involved in multiple cellular processes including lipid metabolism, adipocyte proliferation, and potentially inflammatory responses . Single nucleotide polymorphisms (SNPs) in the OLR1 gene can alter protein function, particularly those resulting in amino acid substitutions. For instance, in humans, the c.501G > C transversion on exon 4 results in an amino acid substitution (p.K167N) that decreases binding and internalization of ox-LDL .

What significant SNPs have been identified in the bovine OLR1 gene?

Multiple SNPs have been identified in the bovine OLR1 gene, with particular focus on those in the 3′ untranslated region (UTR). Three notable SNPs include G10563T, T10588C, and C10647T . These polymorphisms have been studied in various cattle breeds, including Qinchuan cattle. The table below summarizes the haplotype frequencies of these SNPs in Qinchuan cattle:

HaplotypeG10563TT10588CC10647TFrequency (%)
Hap1G1C2C315.70
Hap2G1C2T35.90
Hap3G1T2C342.10
Hap4G1T2T317.60
Hap5T1T2C39.80

Note that linkage disequilibrium (LD) analysis showed that these three SNPs had low linkage (r²<0.001), suggesting high recombination rates in these genomic regions .

How do polymorphisms in the bovine OLR1 gene affect economic traits in cattle?

Several studies have demonstrated significant associations between OLR1 polymorphisms and economically important traits in cattle. In Qinchuan cattle, the T10588C and C10647T polymorphisms were significantly associated with backfat thickness and intramuscular fat (IMF) content . Specifically, individuals with genotype TT at both loci had significantly greater backfat thickness and IMF content than those with genotype CC. This suggests that the T allele at these loci might be associated with increased fat deposition in these cattle. Similar associations have been reported in other cattle breeds, including effects on milk fat percentage in Holstein-Friesian bulls and rib-eye area in Angus steers .

How do 3′ UTR SNPs in OLR1 influence gene expression?

The 3′ UTR SNPs in OLR1 may influence gene expression through modulation of microRNA (miRNA) binding sites. Bioinformatic analysis has revealed that the T10588C and C10647T polymorphisms alter binding sites for specific bovine miRNAs . Specifically, the C allele in T10588C alters the binding site for bta-miR-12047, while the T allele in C10647T modifies the binding site for bta-miR-12021. These alterations in miRNA binding sites may affect post-transcriptional regulation of the OLR1 gene, leading to differences in protein expression levels and ultimately influencing phenotypic traits related to fat metabolism .

What are the optimal methods for cloning and expressing recombinant bovine OLR1?

For optimal cloning and expression of recombinant bovine OLR1, researchers should consider several factors. First, the choice of expression system is crucial—mammalian cell systems often provide better post-translational modifications for membrane proteins like OLR1. The full-length coding sequence (CDS) should be amplified from bovine cDNA derived from tissues with high OLR1 expression, such as liver or adipose tissue. For efficient expression, consider using tissue-specific promoters or strong constitutive promoters like CMV.

When designing expression constructs, researchers should include appropriate purification tags (His, FLAG, etc.) that do not interfere with protein folding or function. Verification of successful expression can be performed using Western blotting with specific antibodies against bovine OLR1 or the added tag, similar to methods used in human LOX-1/OLR1 studies .

What genotyping methods are most effective for OLR1 polymorphism studies?

For OLR1 polymorphism studies, several genotyping methods have proven effective. PCR-RFLP (Restriction Fragment Length Polymorphism) is commonly used for known SNPs like G10563T, T10588C, and C10647T. For this method, primers should be designed to flank the SNP sites, and appropriate restriction enzymes should be selected based on the sequence alterations.

Alternatively, allele-specific PCR or TaqMan assays can provide higher throughput for large-scale studies. For comprehensive analysis of multiple polymorphisms, direct sequencing of the OLR1 gene regions of interest remains the gold standard. When designing genotyping studies, researchers should account for the low linkage disequilibrium between SNPs in the OLR1 gene (as observed in Qinchuan cattle), which may necessitate individual assessment of each polymorphism rather than relying on tag SNPs .

How can researchers validate the functional effects of OLR1 polymorphisms?

Validating the functional effects of OLR1 polymorphisms requires a multi-faceted approach. In vitro, researchers can use luciferase reporter assays to assess the impact of 3′ UTR variants on gene expression by cloning wild-type and variant 3′ UTR sequences downstream of a luciferase reporter gene. For coding region variants, site-directed mutagenesis can be used to introduce specific mutations into expression constructs, followed by functional assays measuring ox-LDL binding and internalization.

Cell-based assays using bovine cell lines (preferably from relevant tissues like liver or adipocytes) can be employed to assess the impact of OLR1 variants on lipid uptake, cell proliferation, and inflammatory responses. For miRNA binding site alterations, co-transfection experiments with the relevant miRNAs (e.g., bta-miR-12047 for T10588C and bta-miR-12021 for C10647T) can help validate predicted interactions . In vivo validation could involve generating transgenic models expressing different OLR1 variants, though this is more challenging in bovine systems.

How can recombinant bovine OLR1 be used to study breed-specific differences in lipid metabolism?

Recombinant bovine OLR1 offers a valuable tool for studying breed-specific differences in lipid metabolism. Researchers can express OLR1 variants identified in different cattle breeds (e.g., Qinchuan, Holstein-Friesian, Angus) and compare their functional properties in standardized assays. This approach allows isolation of genetic effects from environmental and physiological variables that might confound in vivo studies.

Comparative binding assays with ox-LDL and competitive ligands can reveal functional differences between OLR1 variants prevalent in different breeds. Additionally, recombinant OLR1 can be used in protein-protein interaction studies to identify breed-specific differences in downstream signaling pathways. Researchers should design experiments that incorporate prevalent haplotypes such as those identified in Qinchuan cattle (Hap3: G1T2C3, frequency 42.10%) when studying breed-specific effects .

What experimental designs best elucidate the role of OLR1 in bovine adipogenesis?

To elucidate the role of OLR1 in bovine adipogenesis, researchers should consider both gain-of-function and loss-of-function approaches. Stable cell lines with OLR1 overexpression can be established using bovine preadipocytes, similar to methodologies employed for human cell lines . Similarly, knockdown models using shRNA against OLR1 can help determine the necessity of OLR1 in adipogenic processes.

Differentiation assays measuring lipid accumulation (Oil Red O staining), expression of adipogenic markers (PPARγ, C/EBPα), and metabolic parameters should be included in experimental designs. Time-course studies are essential to determine whether OLR1 influences early commitment to adipogenesis or later stages of adipocyte maturation. For in vivo relevance, primary cell cultures from different fat depots (subcutaneous, intramuscular, visceral) should be compared, as the T10588C and C10647T polymorphisms have been associated with variations in backfat thickness and intramuscular fat content in Qinchuan cattle .

How can systems biology approaches incorporate OLR1 data into broader metabolic networks?

Systems biology approaches offer powerful frameworks for integrating OLR1 data into broader metabolic networks. Researchers should combine transcriptomic, proteomic, and metabolomic data to construct comprehensive networks of lipid metabolism in bovine tissues. RNA-seq data from cattle with different OLR1 genotypes can identify co-expressed gene networks and potential regulatory relationships.

Protein-protein interaction studies using recombinant OLR1 as bait can identify novel interaction partners, elucidating the broader signaling network. Metabolic flux analysis in cells expressing different OLR1 variants can reveal how these genetic differences translate to altered metabolic phenotypes. When constructing such networks, researchers should account for the tissue-specific expression patterns of OLR1 in lung, liver, and adipose tissue . Integration of OLR1 haplotype data with production traits can provide systems-level insights into how genetic variation influences economically important traits in cattle.

How should researchers address contradictory findings in OLR1 association studies?

Contradictory findings in OLR1 association studies are not uncommon, as evidenced by inconsistent associations between OLR1 polymorphisms and cardiovascular outcomes in human studies . When encountering such contradictions in bovine research, several approaches should be considered. First, carefully assess population structure and stratification in the studied cattle populations, as these factors can lead to spurious associations or mask true effects.

Sample size considerations are crucial—many early association studies are underpowered, leading to both false positives and false negatives. Meta-analysis approaches combining data from multiple studies can provide more robust estimates of effect sizes. Additionally, phenotype definition should be standardized across studies; for instance, backfat thickness measurement protocols should be consistent to allow meaningful comparisons. Researchers should also consider gene-environment interactions, as the effect of OLR1 variants may depend on diet, management practices, or other environmental factors that vary between studies .

What statistical approaches are most appropriate for analyzing haplotype effects of OLR1 polymorphisms?

When analyzing haplotype effects of OLR1 polymorphisms, several statistical approaches should be considered. For haplotype reconstruction from genotype data, methods like the expectation-maximization algorithm or Bayesian approaches (implemented in software such as PHASE or fastPHASE) are appropriate. Once haplotypes are defined, association analyses should account for the frequency distribution—rare haplotypes (frequency <5%) should typically be excluded or grouped, as was done in the Qinchuan cattle study where five major haplotypes were analyzed .

Linear mixed models are often appropriate for association analyses, incorporating fixed effects (haplotype, sex, age, etc.) and random effects (animal, sire, etc.) to control for population structure and relatedness. When analyzing multiple traits, multivariate approaches can increase power and account for trait correlations. Permutation testing or false discovery rate (FDR) methods should be employed for multiple testing correction. Given the low linkage disequilibrium observed between OLR1 SNPs (D′ values of 0.019-0.094, r² values of 0.000-0.001), researchers should not assume that significant associations with one SNP will extend to nearby variants .

How can researchers effectively compare OLR1 studies across different cattle breeds and experimental systems?

Effective comparison of OLR1 studies across different cattle breeds and experimental systems requires careful consideration of several factors. Standardization of nomenclature is essential—researchers should use consistent naming conventions for polymorphisms (e.g., reference the genomic position based on a standard assembly) and clearly describe the breed characteristics.

Meta-analysis techniques incorporating random effects for breed differences can help identify consistent associations while accounting for breed-specific variation. When comparing functional studies, researchers should consider differences in experimental systems (cell types, expression levels, assay conditions) that might influence outcomes. Cross-breed validation studies, where the same experimental protocols are applied to samples from different breeds, provide the most direct comparisons.

Researchers should be particularly attentive to allele frequency differences between breeds—for instance, the high frequency of the Hap3 (G1T2C3) haplotype in Qinchuan cattle (42.10%) may not be reflected in other breeds, potentially leading to differing association results . Publications should include comprehensive methodological details to facilitate replication and comparison across studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.