Recombinant Bovine Oxytocin receptor (OXTR)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant bovine OXTR retains the canonical seven-transmembrane domain structure of Class A GPCRs, with an extracellular N-terminus and intracellular C-terminus. Key features include:

FeatureDetailSource
Gene locationChromosome 3p25 in cattle (orthologous to human OXTR)
Protein length391 amino acids (predicted from sheep homolog Q28756)
Expression systemTypically produced in E. coli or mammalian cell lines (e.g., HEK293) with His/GST tags
Post-translational modificationsGlycosylation sites in extracellular domains; phosphorylation sites in intracellular loops

The bovine OXTR gene promoter contains estrogen-responsive elements and an interferon-responsive element at -2,400 bp, enabling hormone-dependent regulation and potential cross-talk with immune signaling pathways .

Functional Properties

Recombinant bovine OXTR exhibits ligand-binding kinetics and signaling pathways conserved across mammals:

  • Ligand specificity: Binds oxytocin (OT) with higher affinity than vasopressin (K<sub>d</sub> ≈ 1–2 nM) .

  • Signaling pathways:

    • G<sub>q/11</sub>-PLCβ-PKC cascade → Ca<sup>2+</sup> mobilization

    • β-arrestin-dependent internalization and recycling

  • Cellular responses:

    • Uterine myometrium contraction (EC<sub>50</sub> ≈ 10 nM)

    • Enhanced glucose-stimulated insulin secretion in pancreatic β-cells

Production and Purification

A standard protocol for recombinant OXTR production involves:

  1. Cloning: Bovine OXTR cDNA inserted into expression vectors (e.g., pET-28a for E. coli).

  2. Expression: Induced with IPTG in E. coli BL21(DE3), yielding ~0.5–1.0 mg/L .

  3. Purification: Ni-NTA affinity chromatography for His-tagged proteins (>90% purity via SDS-PAGE) .

Storage: Lyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose; stable at -80°C for >1 year .

Pharmacological Studies

Recombinant bovine OXTR enables high-throughput screening of agonists/antagonists. For example:

  • Atosiban (OTR antagonist) inhibits uterine contractions (IC<sub>50</sub> = 4.7 nM) .

  • Carbetocin (long-acting analog) shows 3-fold higher binding affinity than OT in bovine myometrium .

Disease Modeling

  • Postpartum uterine involution: OXTR persists in bovine endometrium for 7 days postpartum, supporting OT’s ecbolic role .

  • Metabolic disorders: β-cell-specific OXTR knockout (β-KO) mice exhibit impaired glucose tolerance under hyperglycemia .

Challenges and Innovations

ChallengeSolutionProgress
Low expression yieldCodon optimization and use of Pichia pastoris systems
Poor BBB permeabilityDevelopment of non-peptide agonists (e.g., LIT-001) with 10-fold higher bioavailability
Species specificityCross-validation using bovine endometrial epithelial cells

Future Directions

  1. Gene-edited cattle models: CRISPR/Cas9-mediated OXTR knockouts to study parturition disorders.

  2. Therapeutic targeting: OXTR-based drugs for postpartum hemorrhage (global incidence: 14.9/1,000 births) .

  3. Multi-omics integration: Epigenetic profiling of OXTR methylation in stress-related pathologies .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize its development.
Synonyms
OXTR; Oxytocin receptor; OT-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MEGAFAANWSAEAVNGSAAPPGTEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV VGMFASTYLLLLMSLDRCLAICQPLRSLSRRTDRLAVLVTWLGCLVASAPQVHIFSLREV ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLATCYGLISFKIWQNLRLKTAAAAA EAAAGAEGEAADWAGRAILARVSNVKLISKAKIRTVKMTFIVVLAFIVCWTPFFFVQMWS VWDADAPKEASPFIIAMLLASLNSCCNPWIYMLFTGHLFQELVQRFLCCSFRRLKGSRPG ETSVSKKSNSSTFVLSQYSSSQRRCSQPSTL
Uniprot No.

Target Background

Function
Oxytocin receptor is a receptor for oxytocin. Its activity is mediated by G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions
  1. This study investigates the relationship between luteal concentrations of oxytocin (OT), noradrenaline (NA), progesterone (P4), oxytocin receptors (OT-R), and beta(2)-adrenoreceptors (beta(2)-R) gene expression and their protein levels throughout the estrous cycle. PMID: 20149890
  2. This study indicates that components of the interferon system significantly influence the transcription of the bovine oxytocin receptor gene. PMID: 12604656
  3. This study demonstrates the presence of oxytocin receptors (OTR) in oviductal tissues during the follicular phase in cows. PMID: 12935872
  4. This study demonstrates that E2 can stimulate PGF2 alpha secretion by increasing OXTR expression in bovine endometrial cells in vitro, but only after exposure to P4. PMID: 12957670
  5. This study demonstrated that bovine lymphocytes express oxytocin receptors and that this expression can be regulated in a steroid-dependent manner. PMID: 18094352
  6. This study shows that oxytocin receptor down-regulation is not necessary for reducing oxytocin-induced prostaglandin F(2alpha) accumulation by interferon-tau in a bovine endometrial epithelial cell line. PMID: 18832100

Show More

Hide All

Database Links

KEGG: bta:281371

STRING: 9913.ENSBTAP00000026346

UniGene: Bt.140

Protein Families
G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the bovine oxytocin receptor (OXTR) and what are its expression patterns?

The bovine oxytocin receptor (OXTR) is a G protein-coupled receptor that mediates the physiological effects of oxytocin, a neuropeptide hormone. In bovine tissues, OXTR is expressed at high levels in the uterus, particularly during estrus and at term of pregnancy. This expression pattern correlates with increasing estrogen concentration and progesterone withdrawal, suggesting hormonal regulation of receptor availability. The expression of OXTR appears to be controlled primarily at the transcriptional level rather than through post-transcriptional mechanisms .

Bovine OXTR is also expressed in mammary tissue, contributing to milk ejection during lactation. Beyond reproductive tissues, OXTR expression has been detected in various brain regions, where it modulates behaviors and physiological responses. Unlike some other species, bovine OXTR shows unique tissue-specific expression patterns that correspond to its roles in reproduction and lactation.

How is the bovine OXTR gene transcriptionally regulated?

The transcriptional regulation of bovine OXTR involves several mechanisms:

  • Hormonal Regulation: While estrogen appears critical for OXTR expression in vivo, direct estradiol effects on the promoter require specific cofactors. Studies using the 3.2-kb promoter-reporter construct showed estradiol-dependent effects only when cotransfected with steroid receptor cofactors such as SRC1e .

  • Promoter Activity: Functional analyses of the bovine OXTR gene promoter region (approximately 3200 base pairs upstream) reveal that endogenous promoter activity resides in the longest 3.2-kb construct but not in shorter constructs (<1.0 kb). This suggests the presence of important regulatory elements in the distal promoter region .

  • Interferon Regulation: A putative interferon-responsive element (IRE) located approximately -2,400 base pairs from the transcription start site plays a significant role. This element binds IRF1 and IRF2 (interferon regulatory factors) from both mouse models and bovine endometrial and myometrial nuclear extracts .

  • Temporal Expression Patterns: The bovine equivalents to IRF1 and IRF2 are expressed in a temporal fashion in endometrial tissue, supporting the role of interferon-tau in maternal recognition of pregnancy. This represents one of the most significant influences on bovine OXTR gene transcription identified to date .

What are the key considerations for designing expression systems for recombinant bovine OXTR?

When designing expression systems for recombinant bovine OXTR, researchers should consider:

  • Cell Type Selection: Different cell types express varying levels of endogenous OXTR. Human embryonic kidney cells (HEK293T) are commonly used in experimental systems, while human myometrial smooth muscle cells contain endogenous OXTR that may influence experiments .

  • Cell-Specific Binding Parameters: OXT-OXTR binding dynamics differ significantly between cell types. Mathematical modeling has demonstrated that OXTR complex reaches maximum occupancy at 10 nM OXT in myometrial cells but requires 1 μM in HEK293T cells . This approximately 100-fold difference is critical for experimental design and interpreting results.

  • Surface Localization: Cell-surface OXTR concentrations vary across expression systems and must be precisely measured for accurate characterization of receptor function .

  • Association/Dissociation Kinetics: Cell-type specific association rates (kon) and dissociation rates (koff) of OXT-OXTR interaction differ by cell type, species, and even gestational time. The mean affinity constant (Kd) across experiments and species ranges from 0.52-9.32 nM with a mean of 1.48 ± 0.36 nM .

How do genetic variants of bovine OXTR affect ligand binding and functional responses?

Genetic variants of bovine OXTR demonstrate significant effects on OXT-OXTR binding capacity and subsequent functional responses. Studies focusing on five prevalent OXTR variants (V45L, P108A, L206V, V281M, and E339K) revealed:

  • Variant-Specific Effects: The variants V281M and E339K substantially compromise OXT-OXTR binding capacity, with decreases of 55% and 29% in OXTR complex formation, respectively, at high OXT concentrations. In contrast, variants P108A and L206V enhance complex formation by 58% and 81%, respectively .

  • Dose-Response Alterations: Each variant exhibits a unique dose-response profile. The following table summarizes the effects of OXTR variants on complex formation at different OXT concentrations:

OXTR VariantEffect at 10 pM OXTEffect at 10 nM OXTEffect at 1 μM OXT
Wild-typeBaselineBaselineBaseline
P108AIncreasedIncreased+58%
L206VIncreasedIncreased+81%
V281MDecreasedDecreased-55%
E339KDecreasedDecreased-29%
  • Rescue Strategies: For variants with decreased binding capacity (V281M and E339K), increased OXT dosage can rescue the attenuated response. Specifically:

    • V281M OXTR requires 2.5 μM OXT to achieve wild-type level activation for 24 seconds, or 4.5 μM OXT to exceed wild-type activation for 45 seconds

    • E339K OXTR requires 1.5 μM OXT to match wild-type activation for 36 seconds, or 2.5 μM OXT to exceed wild-type activation for 90 seconds

These findings suggest the potential need for personalized oxytocin dosing based on individual genetic profiles to optimize therapeutic efficacy.

What methods are available for measuring OXT-OXTR interactions and activation?

Several methodological approaches enable researchers to measure OXT-OXTR interactions:

  • GPCR Activation-Based (GRAB) Sensors: Genetically encoded sensors using circularly permutated GFP (cpGFP) flanked by linker peptides can directly detect OXT binding. For example, the OT1.0 sensor incorporates cpGFP within the third intracellular loop (ICL3) of bovine OXTR, producing fluorescence changes upon ligand binding .

  • β-Arrestin Recruitment Assays: The Tango assay system measures β-arrestin activation by OXTR. Wild-type bovine OXTR displays robust β-arrestin coupling in response to OXT, while the OT1.0 sensor shows minimal coupling, making it useful for imaging studies without significantly altering endogenous signaling .

  • Calcium Signaling Assays: Measuring Gq-dependent calcium signaling provides a functional readout of OXTR activation. Wild-type bovine OXTR produces detectable calcium signals in response to defined OXT concentrations .

  • Mathematical Modeling: Computational approaches can predict OXT-OXTR binding dynamics using measured parameters such as:

    • Cell-surface OXTR concentrations

    • Association rates (kon): 6.8 × 10^5 M^-1 min^-1

    • Dissociation rates (koff): 0.0011 min^-1

    • Affinity constant (Kd): 1.6 nM

  • In Vivo Fluorescence Measurements: Direct visualization of OXT-OXTR interactions in brain tissue can be achieved through viral expression of OXTR sensors. Dose-dependent fluorescence responses have been recorded with intraventricular OXT administration, reaching over 100% ΔF/F0 at high concentrations. This response can be blocked by pre-injection of oxytocin receptor antagonists such as Atosiban .

How can researchers visualize compartment-specific OXT release and OXTR activation?

Visualizing compartment-specific OXT release and OXTR activation requires sophisticated techniques:

  • Viral Expression of Fluorescent Sensors: Adeno-associated viruses (AAVs) expressing OXT sensors (e.g., OT1.0) can be injected into specific brain regions like the paraventricular nucleus (PVN) in OT-Cre mice .

  • Combination with Chemogenetics: Co-expression of Cre-dependent excitatory Gq-DREADDs (e.g., EF1α-DIO-hM3Dq-mCherry) enables controlled stimulation of oxytocinergic neurons in acute brain slices .

  • Electrophysiological Recordings: Combining fluorescence imaging with electrophysiological recordings allows correlation between neuronal activity and OXT release.

  • In Vivo Measurements: For in vivo applications, viral expression of OXT1.0 sensor in regions like the bed nucleus of stria terminalis (BNST) enables measurement of fluorescent responses to intraventricular OXT injections. This approach has demonstrated dose-dependent increases in fluorescence over a 1,000-fold concentration range .

  • Control Experiments: Using mutated sensors (e.g., OTmut) as negative controls and receptor antagonists (e.g., Atosiban) as pharmacological controls ensures signal specificity. For example, control animals expressing OTmut showed no response to OXT injection at any dosage, confirming the specificity of the OT1.0 sensor response .

What is the relationship between bovine OXTR and interferon signaling during pregnancy?

The relationship between bovine OXTR and interferon signaling during pregnancy reveals a critical mechanism for maternal recognition of pregnancy:

  • Interferon-τ (IFNτ) Regulation: Bovine IFNτ plays a crucial role in maternal-fetal recognition and influences OXTR expression. The bovine OXTR gene contains an interferon-responsive element (IRE) approximately 2,400 base pairs upstream of the transcription start site .

  • Suppression of Prostaglandin F2α: Recombinant bovine IFNτ (rbIFNτ) suppresses oxytocin-induced prostaglandin F2α (PGF2α) production in bovine endometrial epithelial cells in a dose-dependent manner. Concentrations from 1 to 1,000 ng/ml significantly suppress OXT-induced secretion of PGF2α .

  • Embryonic Development: rbIFNτ at 10 ng/ml significantly promotes development of bovine embryos from the morula to the expanded blastocyst stage during in vitro culture .

  • Temporal Expression: IRF1 and IRF2 (interferon regulatory factors) are expressed in a temporal fashion in bovine endometrial tissue, coordinating with the critical window for maternal recognition of pregnancy .

  • Mechanism of Action: The interferon system components (particularly IRF1 and IRF2) represent some of the most significant factors influencing bovine OXTR gene transcription, suggesting a sophisticated signaling network that coordinates pregnancy establishment .

This IFNτ-mediated suppression of OXTR function in the endometrium helps prevent the luteolytic mechanism that would otherwise terminate pregnancy, allowing for successful implantation and maintenance of pregnancy in cattle.

How does OXTR signaling differ between recombinant systems and native cellular contexts?

OXTR signaling shows important differences between recombinant systems and native cellular contexts:

  • Receptor Density Variations: Recombinant expression systems typically produce higher OXTR surface densities than native cells. This affects the apparent potency of OXT, with EC50 values of approximately 5.4 nM in HEK293T cells expressing recombinant OXTR compared to 30 nM in human myometrial cells with endogenous OXTR .

  • Binding Kinetics: Mathematical modeling predicts an EC50 of 4.71 nM for OXT-OXTR binding in HEK293T cells and 14.5 nM in human myometrial cells, aligning with experimental measurements of receptor activation .

  • Signaling Pathway Coupling: Wild-type bovine OXTR couples efficiently to both G-protein and β-arrestin pathways. In contrast, engineered sensor constructs like OT1.0 show minimal β-arrestin coupling while maintaining fluorescent reporting capabilities .

  • Cell-Specific Responses: Maximum OXTR occupancy requires significantly different OXT concentrations depending on the cellular context: 10 nM in myometrial cells versus 1 μM in HEK293T cells - a 100-fold difference that has important implications for experimental design .

  • Regulatory Mechanisms: Native OXTR expression is subject to complex transcriptional regulation including steroid hormone influences and interferon signaling. These regulatory mechanisms are often bypassed in recombinant systems using constitutive promoters .

Researchers should carefully consider these differences when designing experiments and interpreting results, especially when translating findings from recombinant systems to physiological contexts.

What expression systems are most effective for producing functional recombinant bovine OXTR?

Several expression systems have proven effective for producing functional recombinant bovine OXTR, each with distinct advantages:

  • Mammalian Cell Systems: HEK293T cells are commonly used for recombinant OXTR expression due to their high transfection efficiency and mammalian protein processing capabilities. These cells provide appropriate post-translational modifications and membrane insertion for G protein-coupled receptors like OXTR .

  • Baculovirus Expression Systems: The Bombyx mori (silkworm) nuclear polyhedrosis virus expression system has been successfully used for producing recombinant bovine proteins that interact with OXTR. This system offers advantages for large-scale protein production with proper folding and activity .

  • Viral Vector Systems for In Vivo Expression: Adeno-associated viruses (AAVs) enable targeted expression of OXTR constructs in specific tissues. For example, AAVs expressing OXT sensors under the human synapsin promoter (hSyn) have been successfully used to study OXTR function in brain slices .

  • Considerations for Receptor Variants: When expressing OXTR variants, it's essential to quantify cell-surface receptor concentrations, as variants show different surface localization efficiencies that significantly impact experimental outcomes .

To evaluate OXTR functionality across these systems, researchers should assess both binding parameters (kon, koff, Kd) and downstream signaling through calcium mobilization, β-arrestin recruitment, or other relevant pathways.

What methods are most effective for studying OXTR-ligand binding kinetics?

Several methodological approaches are particularly effective for studying OXTR-ligand binding kinetics:

  • Fluorescence-Based Detection: GRAB sensors like OT1.0 enable real-time visualization of OXT binding to OXTR, with fluorescence changes (ΔF/F0) proportional to receptor occupancy. These sensors provide spatiotemporal resolution that traditional binding assays lack .

  • Radioligand Binding Assays: Traditional approaches using radiolabeled OXT provide quantitative measurements of binding parameters, including:

    • Association rate (kon): 6.8 × 10^5 M^-1 min^-1

    • Dissociation rate (koff): 0.0011 min^-1

    • Affinity constant (Kd): 1.6 nM

  • Mathematical Modeling: Computational approaches combining measured parameters with binding equations provide insights into dynamic processes that are difficult to observe experimentally. Models parameterized with cell-specific OXTR surface localization can predict complex formation across different time scales and concentrations .

  • Competition Binding: Using OXT analogs or antagonists (e.g., Atosiban) in competition binding studies helps assess binding site specificity and ligand selectivity. For example, AVP (vasopressin) shows significantly lower OXTR activation than OXT at equivalent concentrations, reflecting the natural selectivity of OXTR .

  • Real-Time Binding Measurements: Techniques such as surface plasmon resonance or bioluminescence resonance energy transfer (BRET) can provide real-time kinetic data on OXTR-ligand interactions without requiring radioactive materials.

How can researchers optimize transfection and expression of recombinant bovine OXTR?

Optimizing transfection and expression of recombinant bovine OXTR requires attention to several key parameters:

  • Codon Optimization: Adapting the bovine OXTR coding sequence to the codon usage preferences of the host expression system can significantly improve protein expression levels.

  • Signal Sequence Modification: Including or optimizing signal sequences facilitates proper membrane targeting. This is particularly important for OXTR, which must be correctly inserted into the plasma membrane for functionality.

  • Expression Vector Selection: Vectors with strong promoters (e.g., CMV for mammalian cells) drive high expression levels, while inducible promoters offer temporal control. For the fluorescent OXT sensor (OT1.0), the insertion site of cpGFP within the third intracellular loop (ICL3) of OXTR is critical for functionality .

  • Transfection Reagent Optimization: Different cell types require different transfection approaches:

    • Lipid-based transfection works well for HEK293T cells

    • Electroporation may be preferable for primary cells like myometrial smooth muscle cells

    • Viral transduction offers higher efficiency for difficult-to-transfect cells

  • Quantification Methods: Surface OXTR expression should be quantified using techniques such as:

    • Flow cytometry with fluorescently-labeled antibodies or ligands

    • Radioligand binding to intact cells

    • Immunofluorescence microscopy with non-permeabilized cells

When working with OXTR variants, it's essential to normalize experimental results to surface expression levels, as variants can show significantly different membrane localization efficiencies .

How does recombinant bovine OXTR contribute to understanding pregnancy establishment in cattle?

Recombinant bovine OXTR has significantly advanced our understanding of pregnancy establishment in cattle through several research applications:

  • Maternal Recognition Mechanisms: Studies using recombinant OXTR have elucidated the critical interaction between interferon-τ (IFNτ) signaling and OXTR expression. The bovine OXTR gene contains an interferon-responsive element (IRE) that binds IRF1 and IRF2, linking maternal recognition of pregnancy to OXTR regulation .

  • Prostaglandin Regulation: Recombinant systems have revealed how IFNτ suppresses oxytocin-induced prostaglandin F2α (PGF2α) production in a dose-dependent manner, with concentrations from 1 to 1,000 ng/ml significantly suppressing OXT-stimulated PGF2α secretion from endometrial epithelial cells .

  • Hormonal Regulation: Transfection studies with promoter-reporter constructs have shown that while estrogen appears important for OXTR expression in vivo, direct estradiol effects require specific cofactors like SRC1e, explaining the complex hormonal regulation during the estrous cycle and pregnancy .

  • Embryonic Development: Research shows that rbIFNτ at 10 ng/ml significantly promotes bovine embryo development from morula to expanded blastocyst stage during in vitro culture, suggesting direct effects of the maternal recognition signal on embryonic development .

  • Genetic Variation Impact: Studies of OXTR variants have demonstrated how genetic differences might influence reproductive outcomes by altering receptor function, with some variants enhancing and others reducing OXTR complex formation .

These findings collectively provide mechanistic insights into the molecular basis of maternal-fetal communication during early pregnancy, offering potential targets for improving reproductive efficiency in cattle.

What is the significance of OXTR genetic variants for bovine reproductive technologies?

The discovery of functional OXTR genetic variants has important implications for bovine reproductive technologies:

  • Personalized Hormone Protocols: OXTR variants (V45L, P108A, L206V, V281M, and E339K) significantly alter OXT binding dynamics, suggesting the need for individualized oxytocin dosing strategies based on genetic profiles. Variants V281M and E339K require substantially higher OXT doses to achieve the same receptor activation as wild-type OXTR .

  • Embryo Transfer Optimization: Understanding OXTR variant effects could lead to customized embryo transfer protocols that account for recipient genetic profiles, potentially improving pregnancy rates.

  • Genetic Selection Strategies: Identifying beneficial OXTR variants (like P108A and L206V, which show enhanced complex formation) could inform breeding programs targeting improved reproductive efficiency.

  • Diagnostic Applications: Genotyping cattle for OXTR variants might predict individual responses to oxytocin treatment during labor induction or other reproductive interventions.

  • Rescue Strategies: Mathematical modeling demonstrates that the attenuated responses of V281M and E339K variants can be rescued by specific dosing strategies:

    • V281M requires 2.5 μM OXT to achieve wild-type activation levels

    • E339K requires 1.5 μM OXT to match wild-type activation

These findings suggest a path toward precision reproductive medicine in cattle based on individual genetic profiles, potentially improving outcomes in artificial insemination, embryo transfer, and parturition management.

What emerging technologies might advance bovine OXTR research?

Several emerging technologies show promise for advancing bovine OXTR research:

  • CRISPR/Cas9 Genome Editing: Precise modification of the bovine OXTR gene could create isogenic cell lines or animal models expressing specific variants, enabling direct comparison of variant effects without confounding genetic differences.

  • Advanced Fluorescent Biosensors: Building on the GRAB sensor technology, next-generation sensors with improved signal-to-noise ratios, spectral properties, or multiplexing capabilities could provide deeper insights into OXTR signaling dynamics .

  • Single-Cell Analysis: Techniques like single-cell RNA-seq could reveal cell-specific OXTR expression patterns and response heterogeneity within tissues, potentially identifying previously unrecognized OXTR-expressing cell populations.

  • Organ-on-Chip Models: Microfluidic systems mimicking bovine endometrial-conceptus interactions could provide controlled platforms for studying OXTR function during early pregnancy in a physiologically relevant context.

  • In Vivo Imaging: Developing methods for non-invasive imaging of OXTR expression or activation in live animals would enable longitudinal studies of receptor dynamics during estrous cycles and pregnancy.

  • AI-Driven Modeling: Machine learning approaches could help predict OXTR variant effects and optimize dosing strategies by integrating multiple parameters, potentially accelerating the development of personalized reproductive protocols .

These technologies, especially when used in combination, have the potential to significantly advance our understanding of bovine OXTR biology and translate into improved reproductive management practices.

How might research on bovine OXTR variants inform human reproductive medicine?

Research on bovine OXTR variants has several translational implications for human reproductive medicine:

  • Pharmacogenomic Applications: The significant effects of bovine OXTR variants on ligand binding and receptor function suggest similar phenomena may occur in humans. Meta-analysis reveals remarkable homogeneity in OXT-OXTR affinity across species (Kd = 0.52-9.32 nM), suggesting conserved binding mechanisms .

  • Personalized Oxytocin Dosing: The computational framework developed for precision oxytocin dosing based on OXTR variants in cattle provides a template for similar approaches in human obstetrics, where oxytocin sensitivity also varies considerably among individuals .

  • Novel Therapeutic Targets: Understanding the molecular mechanisms by which OXTR variants affect signaling may identify novel therapeutic targets for conditions involving oxytocin dysregulation.

  • Improved Experimental Models: Bovine models with defined OXTR variants could serve as more relevant experimental systems for testing interventions before clinical trials, particularly for reproductive applications.

  • Diagnostic Development: Insights into how specific variants alter receptor function could lead to diagnostic tests predicting individual responses to oxytocin during labor, potentially reducing adverse outcomes associated with unpredictable responses to Pitocin (synthetic oxytocin).

The finding that approximately half of U.S. women giving birth annually receive Pitocin, yet experience highly variable responses, underscores the clinical significance of understanding OXTR variant effects . The rescue strategies developed for bovine OXTR variants—providing specific dosages at critical time points—could inform more precise obstetric protocols in human medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.