Recombinant Bovine Palmitoyltransferase ZDHHC9 (ZDHHC9)
Shipped with Ice Packs 
In Stock 
Description
Substrate Specificity
ZDHHC9 demonstrates selectivity for:
Mechanistic Actions
Cardiovascular Regulation
-
Transgenic ZDHHC9 overexpression in mice causes:
Oncogenic Roles
Neurological Implications
-
ZDHHC9 mutations linked to:
Therapeutic Targeting Potential
Approaches under investigation:
-
Small-molecule inhibitors
-
Gene therapy strategies
Clinical correlations:
-
High ZDHHC9 expression reduces median glioblastoma survival from 1380 to 436 days (HR=2.89)
-
Plasma ZDHHC9 levels predict heart failure progression (AUC=0.81)
Technical Considerations for Recombinant Use
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ZDHHC9; Palmitoyltransferase ZDHHC9; Zinc finger DHHC domain-containing protein 9; DHHC-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
ZDHHC9
Target Protein Sequence
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYL
AVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQ
RPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRN
YRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVV
GLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRG
ILPLEESGSRPPSTQEASTSLLPQGPAPIDHLSNEMPEDTSTPEEMPPPEPPEPPQEVTE
AEK
Uniprot No.
Target Background
Function
Recombinant Bovine Palmitoyltransferase ZDHHC9 (ZDHHC9) is a palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. The ZDHHC9-GOLGA7 complex specifically palmitoylates HRAS and NRAS. ZDHHC9 may also palmitoylate the β-2 adrenergic receptor (ADRB2), thereby modulating G protein-coupled receptor signaling.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
