Recombinant Bovine PDZK1-interacting protein 1 (PDZK1IP1)

Shipped with Ice Packs
In Stock

Description

Table 1: Recombinant PDZK1IP1 Production Systems

Host SystemTagPurityApplicationsSource
E. coliHis, GST>90%Structural studiesCreative BioMart
Mammalian CellsFc, DDK>95%Functional assaysCreative BioMart
HEK293Avi, Myc>85%Interaction studiesCreative BioMart

Functional Roles in Cellular Processes

PDZK1IP1 regulates diverse pathways, with implications for both normal physiology and disease:

Proliferation and Cancer Biology

  • Pro-Mitogenic Effects: Overexpression in goat preadipocytes increases EdU-positive cells and upregulates CCND1 and CDK2, key cell cycle regulators .

  • Oncogenic Potential: In humans, PDZK1IP1 promotes tumor growth via glucose uptake and redox balance (e.g., NADPH/glutathione synthesis) .

Adipogenesis and Autophagy

  • Anti-Adipogenic Role: PDZK1IP1 inhibits goat subcutaneous preadipocyte differentiation by activating autophagy (LC3-II upregulation, p62 degradation) .

  • Mechanism: Enhances autophagosome formation, which suppresses lipid accumulation and adipogenic markers (PPARγ, C/EBPα) .

TGF-β/BMP Signaling Modulation

  • Smad4 Interaction: PDZK1IP1 traps Smad4 in the cytoplasm, blocking TGF-β/BMP-induced R-Smad/Smad4 complex formation .

  • Pathway Inhibition: Reduces TGF-β-mediated cell migration and growth arrest .

Key Reagents

  • Antibodies: Proteintech’s MAP17 antibody (12518-1-AP) validates PDZK1IP1 expression in IHC and IF .

  • Knockdown/Overexpression Tools: siRNA and plasmid vectors used to study adipogenesis and cancer pathways .

Table 2: PDZK1IP1-Associated Pathways and Interactors

Pathway/ProcessKey MoleculesFunctional Outcome
TGF-β SignalingSmad4, R-SmadsGrowth inhibition suppression
Glucose MetabolismSGLT transporters, NADPHEnhanced redox capacity
AutophagyLC3-II, p62Adipogenesis inhibition

Disease Models

  • Cancer Xenografts: PDZK1IP1 overexpression in CRC cells increases tumor growth under oxidative stress .

  • Adipose Tissue Studies: Used to explore obesity-related metabolic dysregulation in ruminants .

Unresolved Questions and Future Directions

  • Species-Specific Functions: Bovine PDZK1IP1’s role in lactation or muscle development remains unexplored.

  • Therapeutic Targeting: Potential for PDZK1IP1 inhibition in cancers reliant on TGF-β signaling .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life for lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PDZK1IP1; PDZK1-interacting protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
PDZK1IP1
Target Protein Sequence
MSVLSLVVLSLLMALPPASCQQGRGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEKPA PINMVMTIGNKADGILVGTDGKYSSMAASFRSSEHENAYENIPEEEGKVCSTPM
Uniprot No.

Target Background

Database Links

KEGG: bta:613915

UniGene: Bt.20855

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is PDZK1IP1 and what are its known biological functions?

PDZK1IP1 is an epithelium-specific membrane-associated non-glycosylated protein that was originally identified as an epithelium-specific molecule . It has multiple roles in cellular processes, acting as a regulator in various contexts:

  • In cancer: PDZK1IP1 is expressed at high levels in various human carcinomas and can influence tumor development through multiple mechanisms .

  • In signaling: It interacts with components of the TGF-β signaling pathway, particularly Smad4, thereby suppressing TGF-β signaling .

  • In metabolism: PDZK1IP1 enhances the reductive capacity of cancer cells via the pentose phosphate pathway and increases glucose uptake .

  • In adipogenesis: PDZK1IP1 functions as a repressor of adipocyte differentiation by promoting autophagy .

  • In stem cells: It is expressed in hematopoietic stem cell (HSC) populations but is reduced in more differentiated cells .

The diverse functions of PDZK1IP1 highlight its significance in both normal physiology and pathological conditions.

What experimental systems are commonly used to study PDZK1IP1?

Researchers employ various experimental systems to investigate PDZK1IP1 functions:

  • Cell culture models:

    • Human carcinoma cell lines for cancer-related studies

    • Goat subcutaneous preadipocytes for adipogenesis research

    • A549 cells for TGF-β signaling studies

  • Animal models:

    • Xenograft tumor models in nude mice

    • Transgenic mouse models expressing GFP under the PDZK1IP1 promoter for stem cell research

  • Genetic manipulation techniques:

    • Overexpression studies using plasmid transfection

    • Knockdown experiments using RNA interference

    • CRISPR/Cas9 genome editing for functional domain analysis

  • Reporter assays:

    • TGF-β signaling reporter assays to measure pathway activation

    • Proximity ligation assays (PLA) to detect protein-protein interactions

These diverse experimental systems enable comprehensive investigation of PDZK1IP1's multifaceted roles across different biological contexts.

How do researchers purify recombinant bovine PDZK1IP1 for experimental use?

While the search results don't specifically address purification methods for bovine PDZK1IP1, researchers typically employ the following approaches based on standard recombinant protein techniques:

  • Expression system selection:

    • Bacterial systems (E. coli) for high yield but potential issues with protein folding

    • Mammalian expression systems for proper post-translational modifications

    • Insect cell systems (baculovirus) as a compromise between yield and proper folding

  • Affinity tag strategy:

    • His-tag purification using nickel or cobalt affinity chromatography

    • GST-fusion proteins purified via glutathione sepharose

    • FLAG or HA-tagged constructs for immunoaffinity purification

  • Purification optimization:

    • Buffer composition optimization to maintain protein stability

    • Addition of reducing agents if the protein contains cysteine residues

    • Temperature control during purification to minimize degradation

  • Quality control methods:

    • SDS-PAGE and Western blotting to verify purity and identity

    • Mass spectrometry for accurate molecular weight determination

    • Functional assays to confirm biological activity post-purification

Research-specific modifications to these protocols would depend on the particular structural characteristics of bovine PDZK1IP1 and the intended experimental applications.

How does PDZK1IP1 influence the TGF-β signaling pathway at the molecular level?

PDZK1IP1 functions as a negative regulator of the TGF-β signaling pathway through direct interaction with Smad proteins, particularly Smad4. The molecular mechanism involves:

  • Protein-protein interactions:

    • PDZK1IP1 interacts with Smad2, Smad3, and Smad4, with the strongest interaction observed with Smad2 and Smad4 .

    • The interaction is dependent on ALK5 (TGF-β type I receptor) activation .

    • PDZK1IP1 also interacts with Smad8 upon BMP receptor activation .

  • Functional domain analysis:

    • The middle region of PDZK1IP1, specifically from Phe40 to Ala49, plays a critical role in its Smad4-regulating activity .

    • Deletion of this region abolishes the inhibitory effect on TGF-β signaling .

    • The strength of Smad4 association diminishes proportionally with truncation of the N-terminal region of PDZK1IP1 .

  • Signaling consequences:

    • PDZK1IP1 knockdown enhances expression of TGF-β target genes, including Smad7 and TMEPAI .

    • Overexpression of PDZK1IP1 suppresses TGF-β-induced reporter activities .

    • PDZK1IP1 inhibits TGF-β-mediated cell migration and growth inhibition .

These molecular interactions provide a mechanistic explanation for how PDZK1IP1 modulates TGF-β signaling, which has significant implications for both normal development and disease states.

What is the paradoxical role of PDZK1IP1 in cancer progression?

The literature presents apparently contradictory roles for PDZK1IP1 in cancer, functioning as both a tumor promoter and potential tumor suppressor depending on context:

  • Evidence supporting tumor-promoting activity:

    • PDZK1IP1 is overexpressed in various human carcinomas .

    • It inhibits tumor necrosis factor-α-induced G1 arrest by impairing p21 induction .

    • PDZK1IP1 maintains phosphatidylinositol 3-kinase/Akt signaling in low serum conditions .

    • PDZK1IP1-expressing cells demonstrate enhanced proliferation in nude mice .

    • It increases reactive oxygen species, which correlates with tumorigenicity .

    • PDZK1IP1 can activate Notch signaling to regulate cancer stem cell populations .

  • Evidence supporting tumor-suppressive activity:

    • In colorectal cancer (CRC), PDZK1IP1 has been suggested to act as a tumor suppressor .

    • In a xenograft tumor model where TGF-β promotes tumors, PDZK1IP1 overexpression decreased tumor size and increased survival rates .

    • PDZK1IP1 suppresses TGF-β signaling, which can be tumor-promoting in advanced cancers .

  • Context-dependent regulation:

    • The tumor microenvironment influences PDZK1IP1 function through super-enhancer activation .

    • Inflammation in the tumor microenvironment can induce PDZK1IP1 expression .

    • The metabolic state of cancer cells may determine whether PDZK1IP1's effects are net positive or negative for tumor growth .

This paradoxical behavior highlights the importance of context-specific analysis when studying PDZK1IP1 in cancer, suggesting that its role may vary depending on cancer type, stage, and microenvironmental factors.

How does PDZK1IP1 regulate cellular metabolism, particularly in cancer cells?

PDZK1IP1 exerts significant influence on cellular metabolism, particularly affecting glucose metabolism and cellular redox status:

  • Pentose phosphate pathway enhancement:

    • PDZK1IP1 overexpression increases flux through the pentose phosphate pathway .

    • This metabolic reprogramming enhances the reductive capacity of cancer cells .

    • Increased NADPH production supports redox homeostasis in cancer cells .

  • Redox regulation:

    • PDZK1IP1 increases cellular levels of glutathione, a major cellular antioxidant .

    • It enhances NADPH levels, which are crucial for maintaining reduced glutathione .

    • The correlation between PDZK1IP1 expression and reactive oxygen species suggests a complex relationship with cellular redox state .

  • Glucose metabolism:

    • PDZK1IP1 overexpression increases glucose uptake in cancer cells .

    • This metabolic shift may support the increased biosynthetic needs of rapidly dividing cancer cells.

    • The enhanced metabolic capacity enables efficient growth under oxidative conditions .

  • Methodological approaches to study these effects:

    • Metabolic flux analysis using isotope-labeled glucose

    • Measurement of key metabolites using mass spectrometry

    • Assessment of enzyme activities in relevant metabolic pathways

    • Determination of cellular redox status through glutathione and NADPH quantification

These metabolic effects have significant implications for cancer cell survival and growth, particularly under the oxidative stress conditions frequently encountered in the tumor microenvironment.

What mechanisms underlie PDZK1IP1's role in regulating adipogenesis?

PDZK1IP1 functions as a repressor of adipocyte differentiation, with autophagy playing a critical role in this regulatory mechanism:

  • Effect on adipocyte differentiation:

    • Overexpression of PDZK1IP1 inhibits the differentiation of goat subcutaneous preadipocytes .

    • Knockdown of PDZK1IP1 produces the opposite effect, enhancing differentiation .

    • These effects can be visualized and quantified using Oil Red O staining .

  • Autophagy regulation:

    • PDZK1IP1 overexpression promotes autophagy in preadipocytes .

    • Conversely, PDZK1IP1 knockdown reduces autophagy .

    • Inhibition of autophagy rescues the PDZK1IP1-induced differentiation restraint .

  • Proposed regulatory pathway:

    • PDZK1IP1 → Enhanced autophagy → Inhibition of adipocyte differentiation

    • This suggests that autophagy acts as a mediator between PDZK1IP1 and adipogenic regulation.

  • Experimental approaches:

    • Gain and loss of function studies through overexpression and knockdown

    • Assessment of adipogenic markers at protein and mRNA levels

    • Autophagy monitoring using LC3-II/LC3-I ratio and other markers

    • Rescue experiments using autophagy inhibitors

This regulatory mechanism identifies PDZK1IP1 as a potential target for modulating adipose tissue development and related metabolic disorders.

What is the role of PDZK1IP1 in inflammation and the immune microenvironment?

PDZK1IP1 exhibits strong connections with inflammatory processes and immune regulation:

  • Correlation with inflammatory diseases:

    • A clear correlation exists between MAP17 (PDZK1IP1) expression and inflammatory diseases .

    • MAP17 appears to be causal in the inflammatory phenotype .

  • Inflammatory pathway regulation:

    • Gene ontology (GO) analysis reveals MAP17 correlation with defense response (p-value: 3.72×10-30), response to stress (2.48×10-23), and immune response (1.05×10-23) .

    • Inflammatory response shows a relatively low p-value (5.03×10-16) in correlation analyses .

  • Association with immune-related genes:

    • Strong overrepresentation of human leukocyte antigen (HLA) family members correlates with MAP17 expression .

    • Nine HLA family members (F, G, B, J, C, E, DMA, A, and DRA) positively correlate with MAP17 in at least 15 databases .

    • Additional HLA genes (DOB, DPA1, DMB, DQB1, DMB, and DQB1) appear in at least 10 analyzed databases .

  • Inflammasome connection:

    • PYCARD, CASP1, and CASP8, essential components of the inflammasome platform, positively correlate with MAP17 .

    • These inflammasome components trigger inflammatory responses and appear highly represented in multiple tumor types .

    • Other inflammasome components (CASP5, NLRP1, NLRP3, NLRC4) also show correlation with MAP17 in various tumors .

  • Interleukin correlation:

    • Proinflammatory cytokine IL-1B positively correlates with MAP17 in all examined tumors .

    • Additional interleukins (IL-15, IL-18, IL-1A, IL-32, IL-7) and their receptors also show correlation .

    • PYCARD and CASP1, involved in IL-1B maturation, significantly increase with high MAP17 levels .

These findings suggest PDZK1IP1/MAP17 may serve as both a marker and potential mediator of inflammation, with significant implications for understanding and potentially modulating inflammatory processes in various disease states.

How is PDZK1IP1 involved in hematopoietic stem cell regulation?

PDZK1IP1 demonstrates a significant role in hematopoietic stem cell (HSC) biology, particularly in the most primitive stem cell compartments:

These findings indicate that PDZK1IP1 serves as both a marker and potentially a functional regulator of the most primitive hematopoietic stem cells, with significant implications for understanding HSC biology and potential applications in stem cell transplantation.

What techniques are most effective for analyzing PDZK1IP1's protein-protein interactions?

Researchers employ various complementary techniques to investigate PDZK1IP1's protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Used to detect interactions between PDZK1IP1 and Smad proteins .

    • Reveals interaction strength and specificity depending on signaling pathway activation.

    • Limited sensitivity for detecting weak or transient interactions.

  • Proximity Ligation Assay (PLA):

    • Successfully employed when traditional Co-IP failed to detect endogenous interactions between PDZK1IP1 and Smad4 .

    • Provides visualization of protein interactions in situ with high sensitivity.

    • Enables detection of interactions only when proteins are within 40 nm of each other.

  • Deletion mutant analysis:

    • Creation of PDZK1IP1 variants to map critical interaction domains .

    • Identified the middle region (Phe40 to Ala49) as essential for Smad4 interaction .

    • Crucial for determining the functional significance of specific protein domains.

  • Reporter assays:

    • Used to assess the functional consequences of PDZK1IP1-Smad interactions on TGF-β signaling .

    • Provides quantitative measurement of pathway activity.

    • Links physical interactions to biological outcomes.

  • Recommended workflow for comprehensive interaction analysis:

    • Initial screening with yeast two-hybrid or mass spectrometry-based approaches

    • Validation with Co-IP and Western blotting

    • High-resolution mapping using deletion/point mutants

    • Functional validation using reporter assays and cellular phenotypes

    • In situ confirmation with PLA or FRET-based techniques

This multi-technique approach provides robust validation of protein interactions and their functional significance in various biological contexts.

How can researchers distinguish between direct and indirect effects of PDZK1IP1 on cellular pathways?

Distinguishing direct from indirect effects of PDZK1IP1 requires rigorous experimental design:

  • Temporal analysis:

    • Time-course experiments tracking the sequence of events following PDZK1IP1 manipulation

    • Rapid changes (minutes to hours) are more likely direct effects

    • Delayed responses (hours to days) may indicate indirect mechanisms

  • Domain-specific mutants:

    • Creation of PDZK1IP1 mutants lacking specific functional domains

    • For example, the Phe40-Ala49 region is critical for Smad4 interaction

    • Loss of function with specific mutants confirms direct mechanism

  • In vitro reconstitution:

    • Purified recombinant proteins in cell-free systems

    • Direct effects should be reproducible with isolated components

    • For example, direct interaction with purified Smad proteins

  • Rescue experiments:

    • Example: Inhibiting autophagy rescues PDZK1IP1-induced differentiation restraint in preadipocytes

    • Confirms autophagy as a mediator between PDZK1IP1 and adipogenesis

    • Establishes causal relationships in multi-step pathways

  • Proximity-based labeling:

    • BioID or APEX2 fusion proteins to identify proteins in close proximity to PDZK1IP1

    • Helps distinguish direct binding partners from downstream effectors

  • Conditional/inducible systems:

    • Allows precise temporal control of PDZK1IP1 expression

    • Enables discrimination between immediate and secondary effects

These approaches, especially when used in combination, provide robust evidence for distinguishing direct molecular interactions from downstream pathway effects.

What are the optimal experimental conditions for studying PDZK1IP1's role in the tumor microenvironment?

The study of PDZK1IP1 in the tumor microenvironment requires careful consideration of experimental systems that preserve the complexity of tumor-stroma interactions:

  • Primary tissue analysis:

    • Use of freshly resected primary tumors and patient-matched adjacent normal tissue

    • Preserves the native epigenetic landscape, which differs significantly from cell lines

    • Enables identification of tumor microenvironment-dependent features

  • 3D culture systems:

    • Co-culture of cancer cells with stromal components (fibroblasts, immune cells)

    • Organoid cultures that better recapitulate tissue architecture

    • Enables study of epithelial-stromal interactions in a controlled environment

  • Cytokine treatment models:

    • Treatment with tumor microenvironment-relevant cytokines can restore PDZK1IP1 super-enhancer activation

    • Mimics inflammatory conditions found in tumors

    • Allows mechanistic studies of how inflammation regulates PDZK1IP1

  • In vivo models:

    • Xenotransplantation into nude mice has been shown to restore PDZK1IP1 expression patterns

    • Provides physiologically relevant microenvironment

    • Enables study of PDZK1IP1's role in tumor growth and metastasis

  • Epigenetic profiling:

    • Analysis of super-enhancers and other regulatory elements

    • Comparison between primary tumors, normal tissue, and cell lines

    • Identification of microenvironment-dependent epigenetic regulation

  • Metabolic analysis under appropriate conditions:

    • Study of PDZK1IP1's metabolic effects under oxidative conditions relevant to tumor microenvironment

    • Measurement of glucose uptake, pentose phosphate pathway activity, and redox state

    • Assessment of how these metabolic changes affect tumor cell survival and growth

These approaches collectively enable robust investigation of PDZK1IP1's functions within the complex tumor microenvironment, providing insights that may not be apparent in simplified experimental systems.

What are the potential therapeutic implications of targeting PDZK1IP1?

Based on its diverse roles in cellular processes, PDZK1IP1 presents several potential therapeutic applications:

  • Cancer therapy:

    • Context-dependent targeting based on tumor type and stage

    • Potential synergy with TGF-β pathway inhibitors

    • Metabolic intervention targeting PDZK1IP1-induced changes in glucose metabolism and redox capacity

    • Consideration of dual roles as both tumor promoter and potential suppressor

  • Inflammatory disorders:

    • Given its causal role in inflammatory phenotypes

    • Potential target for modulating HLA expression and inflammasome activation

    • Intervention in IL-1β processing pathway that correlates with PDZK1IP1

  • Metabolic disorders:

    • Potential target for adipose tissue disorders based on its role in adipogenesis

    • Modulation of autophagy in metabolic tissues

    • Consideration of effects on glucose metabolism and pentose phosphate pathway

  • Stem cell applications:

    • Potential marker for isolating the most primitive HSCs

    • Possible target for expanding HSCs ex vivo for transplantation

    • Consideration for regenerative medicine applications

  • Drug development considerations:

    • Small molecule inhibitors targeting protein-protein interactions (e.g., PDZK1IP1-Smad4)

    • Biologics targeting extracellular domains

    • Targeted degradation approaches (PROTACs)

    • Gene therapy approaches for hard-to-drug contexts

The therapeutic potential of PDZK1IP1 targeting requires careful consideration of its context-dependent functions and the development of highly specific interventions to avoid unintended consequences in non-target tissues.

What are the critical unresolved questions about PDZK1IP1 function?

Despite significant advances in understanding PDZK1IP1, several critical questions remain unresolved:

  • Structural biology:

    • What is the three-dimensional structure of PDZK1IP1?

    • How does this structure facilitate its diverse protein-protein interactions?

    • What conformational changes occur upon binding to partners like Smad4?

  • Regulation:

    • How is PDZK1IP1 expression regulated at the transcriptional, post-transcriptional, and post-translational levels?

    • What factors determine its cell type-specific expression patterns?

    • How do microenvironmental factors influence super-enhancer activation ?

  • Species-specific functions:

    • Do the functions of PDZK1IP1 differ significantly between bovine, human, mouse, and other species?

    • Are there species-specific interaction partners or regulatory mechanisms?

  • Reconciliation of contradictory roles:

    • What determines whether PDZK1IP1 acts as a tumor promoter or suppressor in a given context ?

    • How can we predict its function in specific cellular contexts?

  • Mechanistic details:

    • How exactly does PDZK1IP1 enhance the pentose phosphate pathway and glucose uptake ?

    • What is the precise molecular mechanism by which it promotes autophagy in adipocytes ?

    • How does it regulate hematopoietic stem cell function and maintenance ?

  • Therapeutic targeting:

    • What are the most effective approaches to modulate PDZK1IP1 function for therapeutic benefit?

    • How can we target it in a context-specific manner to avoid unintended consequences?

Addressing these questions will require integrated approaches combining structural biology, systems biology, and advanced in vivo models to fully elucidate PDZK1IP1's complex biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.