Recombinant Bovine Peripheral myelin protein 22 (PMP22)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Bovine PMP22

Peripheral Myelin Protein 22 (PMP22) is one of the major glycosylated transmembrane proteins of the peripheral nervous system (PNS) myelin. The protein is expressed synchronously with myelin formation and localizes almost exclusively in the compact myelin sheath . The structural analysis of PMP22 reveals that it consists of four transmembrane domains and two extracellular domains, carrying an L2/HNK1 carbohydrate chain . This structural organization is critical for its function in maintaining myelin integrity and stability.

The bovine variant of PMP22, while sharing significant homology with human and mouse counterparts, possesses unique sequence characteristics that make it valuable for comparative studies. Like its counterparts in other mammals, bovine PMP22 is involved in the formation and maintenance of compact myelin in the peripheral nervous system. Research has demonstrated that PMP22 forms complexes with another major myelin protein, Protein Zero (P0), in the myelin membrane, suggesting a cooperative role in myelin structure and function . This protein-protein interaction appears to be glycosylation-independent, as coimmunoprecipitation experiments have shown that complex formation occurs regardless of glycosylation status.

The pattern of expression for PMP22 correlates directly with myelin formation processes, highlighting its essential role in the development and maintenance of healthy peripheral nerves. When properly functioning, bovine PMP22 contributes to the structural integrity of myelin, which is crucial for efficient nerve conduction in the peripheral nervous system.

Molecular Structure and Biophysical Properties

The molecular structure of recombinant bovine PMP22 follows the general architecture established for this protein across species. Sequence analyses and topology studies confirm that bovine PMP22, like its human counterpart, consists of four transmembrane domains connected by two extracellular loops and intracellular segments . This structural arrangement places PMP22 in the tetraspan transmembrane protein family, a group of proteins known for their roles in membrane organization and cellular adhesion.

A particularly significant aspect of PMP22's structure is its susceptibility to misfolding. Studies on PMP22 variants have demonstrated that conformational stability directly impacts the protein's ability to traffic correctly through the cellular quality control machinery. The stability of the zinc-bound form of PMP22 appears particularly relevant to pathogenic mechanisms, with mutations causing severe disease exhibiting the largest energetic effects on zinc binding . This relationship between conformational stability and cellular trafficking efficiency has significant implications for understanding how mutations in PMP22 lead to disease states.

The folding efficiency of wild-type PMP22 in cellular systems is relatively low, with only approximately 20% of synthesized protein typically reaching the plasma membrane . This inefficiency increases dramatically with pathogenic mutations, as demonstrated by quantitative trafficking efficiency studies. The following table summarizes the relationship between PMP22 stability and cellular trafficking:

PMP22 Variant TypeAverage Trafficking EfficiencyCellular RetentionDisease Association
Wild-type PMP2217 ± 3%ModerateNone
Non-pathogenic variantsSimilar to wild-typeModerateNone
Mild disease variantsSimilar to wild-typeModerateMild neuropathy
Severe disease variantsMarkedly decreasedHighSevere neuropathy

When reconstituted into lipid bilayers, purified PMP22 demonstrates a remarkable property: it induces the formation of compressed and cylindrically wrapped protein-lipid vesicles that share organizational traits with compact myelin of peripheral nerves . This suggests that PMP22 possesses intrinsic properties that contribute to the characteristic architecture of myelin, potentially explaining its critical role in myelin formation and stability.

Recombinant Production and Purification Methodologies

The production of recombinant bovine PMP22 presents significant challenges due to the protein's hydrophobic nature and tendency to misfold. Expression systems for recombinant PMP22 must be carefully selected to maximize correct folding and minimize aggregation. Several expression systems have been employed for PMP22 production, including bacterial, insect, and mammalian cell cultures, each with distinct advantages and limitations.

For functional studies, mammalian expression systems are often preferred as they provide the closest approximation to the native cellular environment. Studies have utilized various cell lines, including Cos7 and RT4 cells, for the expression of recombinant PMP22 to evaluate trafficking and localization . In these systems, wild-type PMP22 demonstrates the expected trafficking pattern with approximately 20% efficiency to the plasma membrane, while mutant variants show varying degrees of retention in the endoplasmic reticulum (ER).

Purification of recombinant bovine PMP22 typically involves detergent solubilization followed by chromatographic techniques. Once purified, the protein can be reconstituted into lipid vesicles for functional and structural studies. This reconstitution is particularly valuable for investigating PMP22's role in membrane organization, as it allows direct observation of the protein's effects on lipid bilayer structure .

The quality control of recombinant bovine PMP22 production is critical, as the protein's tendency to misfold can lead to heterogeneous preparations. Techniques such as circular dichroism spectroscopy and thermal stability assays are commonly employed to assess the conformational integrity of purified recombinant PMP22. The following table outlines key considerations in recombinant bovine PMP22 production:

Production AspectChallengesStrategies
Expression systemMembrane protein expression, misfoldingMammalian cells for functional studies, E. coli for structural work
SolubilizationMaintaining native structureOptimized detergent selection
PurificationAggregation, low yieldsAffinity tags, optimized chromatography conditions
Quality controlConformational heterogeneityBiophysical characterization, functional assays
ReconstitutionMaintaining functionControlled lipid composition, gentle reconstitution methods

Functional Properties and Biological Interactions

Recombinant bovine PMP22 exhibits functional properties closely aligned with its role in myelin formation and maintenance. When properly folded and trafficked to the plasma membrane, PMP22 participates in critical protein-protein interactions that contribute to myelin compaction and stability. One of the most significant interactions identified is the complex formation between PMP22 and myelin protein zero (P0), another major component of peripheral myelin .

Coimmunoprecipitation experiments have conclusively demonstrated that P0 and PMP22 form complexes in the myelin membrane, and this interaction appears to be independent of glycosylation . The functional significance of this interaction lies in its contribution to the adhesive forces that maintain compact myelin structure. When both proteins are coexpressed in heterologous cells, they colocalize at apposed plasma membranes, suggesting their cooperative role in membrane adhesion .

Beyond its structural role, PMP22 appears to influence membrane architecture directly. Reconstitution studies have shown that purified PMP22 incorporated into lipid vesicles induces the formation of membrane assemblies remarkably similar to compact myelin . This property suggests that PMP22 actively contributes to the specialized membrane organization required for efficient nerve conduction, rather than merely serving as a structural component.

The conformational stability of PMP22 directly impacts its functional efficacy. Studies comparing wild-type and mutant variants demonstrate that destabilizing mutations compromise trafficking efficiency and ultimately reduce the concentration of mature PMP22 at the plasma membrane . This reduction in properly localized protein underlies the pathological mechanisms of many PMP22-associated neuropathies.

Applications in Neuropathy Research and Therapeutic Development

Recombinant bovine PMP22 serves as a valuable tool in neuropathy research, particularly for investigating the molecular mechanisms underlying hereditary peripheral neuropathies. The most common forms of Charcot-Marie-Tooth disease (CMTD) are associated with PMP22 genetic alterations, making this protein a focal point for therapeutic development efforts .

One promising research direction involves targeted genome editing of the PMP22 gene to modulate its expression levels. Studies using CRISPR/Cas9 to target the TATA-box of the PMP22 P1 promoter have demonstrated significant therapeutic potential in mouse models of CMTD . By reducing PMP22 overexpression, this approach ameliorates both histopathological and electrophysiological deficits associated with the disease.

The effectiveness of this approach is demonstrated by improvements in several key parameters:

ParameterEffect of PMP22-TATA CRISPR TreatmentSignificance
Myelinated axonsIncreased numberImproved nerve conduction
Unmyelinated axonsReduced numberReduction in pathology
'Onion bulb' formationsReduced numberReduced demyelination/remyelination cycles
Motor nerve conduction velocitySignificantly increasedImproved nerve function
Compound muscle action potentialSignificantly increasedEnhanced neuromuscular transmission

Importantly, these therapeutic effects have been observed both when treatment is administered at an early stage (p6, prevention paradigm) and after symptom onset (p21, treatment paradigm) . This suggests a potential therapeutic window for PMP22-targeted interventions in human neuropathies.

Beyond direct therapeutic applications, recombinant bovine PMP22 provides a platform for screening potential drug candidates that might stabilize the protein's conformation or enhance its trafficking efficiency. By understanding the biophysical properties that govern PMP22 folding and trafficking, researchers can design targeted interventions to address the underlying pathological mechanisms in PMP22-associated neuropathies.

Pathogenic Mechanisms in PMP22-Related Disorders

Understanding the pathogenic mechanisms of PMP22 mutations has been significantly advanced through studies using recombinant protein systems. These investigations have revealed that mutations in PMP22 can disrupt normal protein function through several mechanisms, including misfolding, altered trafficking, and changes in protein-protein interactions.

A prime example is the exon 4 deletion mutation in PMP22, which results in the loss of 47 amino acids (positions 60-106) . This mutation causes significant intracellular retention of the protein, with fivefold to sixfold higher percentages of cells demonstrating retention of mutant PMP22 compared to wild-type protein . The mutant protein accumulates in the endoplasmic reticulum, failing to reach the plasma membrane where it would normally function.

The conformational stability of PMP22 is closely linked to its pathogenic potential. Studies have shown that pathogenic mutations exhibit differential effects on the apoprotein and zinc-bound forms of PMP22, with mutations responsible for severe disease (Dejerine-Sottas Syndrome) showing the largest energetic effects on zinc binding . These findings suggest that the zinc-bound form of PMP22 may be particularly relevant to understanding pathogenic misfolding mechanisms.

The relationship between conformational stability and cellular trafficking efficiency provides insight into how mutations lead to disease states. In quantitative trafficking studies, mutations associated with severe disease phenotypes demonstrated markedly decreased trafficking efficiencies and high degrees of intracellular retention . The following table illustrates this relationship:

Disease SeverityEffect on PMP22 StabilityEffect on TraffickingIntracellular Retention
Non-pathogenicMinimalSimilar to wild-typeLow to moderate
Mild diseaseModerate destabilizationSimilar to wild-typeModerate
Severe diseaseSignificant destabilizationMarkedly decreasedHigh

These findings highlight the potential value of therapeutic approaches aimed at enhancing PMP22 folding stability or improving its trafficking efficiency through the secretory pathway.

Comparative Analysis with PMP22 from Other Species

Comparative analysis of bovine PMP22 with its counterparts from other species provides valuable insights into evolutionarily conserved features and species-specific adaptations. While the search results don't provide specific information about bovine PMP22 sequence homology, general principles of PMP22 conservation can be applied to understand its likely characteristics.

PMP22 is highly conserved across mammalian species, with significant sequence homology particularly in the transmembrane domains and functional regions. This conservation reflects the critical importance of PMP22 in peripheral nerve myelination across vertebrates. The four-transmembrane domain structure, with two extracellular loops and the L2/HNK1 carbohydrate modification, represents a conserved structural motif essential for proper function .

Despite this high conservation, species-specific variations in PMP22 sequence and expression patterns exist. These variations may contribute to differences in myelin stability, nerve conduction properties, and susceptibility to demyelinating conditions across species. Understanding these differences is particularly valuable for translational research, as it helps define the applicability of animal models to human disease.

For experimental purposes, animal models with varying copy numbers of PMP22 have been developed to mimic different disease scenarios. These include transgenic mice (C22) carrying seven to eight copies of human PMP22, resulting in approximately 2.7-fold overexpression compared to endogenous mouse PMP22 . Other models, such as C3 mice or PMP22 transgenic rats carrying four copies of human PMP22 or three copies of mouse PMP22, respectively, provide more moderate overexpression that more closely approximates the human disease condition .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your preference.
Synonyms
PMP22; Peripheral myelin protein 22; PMP-22; PAS positive glycoprotein; PASII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
PMP22
Target Protein Sequence
MLLLLLGIIVLHVAVLVLLFVSTIVSQWMVGNGHATDLWQNCSTSLMGSVQHCFSSSANE WLQSVQATMILSIIFSVLSLFLFFCQLFTLTKGGRFYITGVFQILAGLCVMSAASIYTVR HPEWHFNSDGSYGFAYILAWVAFPLALLSGVIYVILRKRE
Uniprot No.

Target Background

Function
Peripheral myelin protein 22 (PMP22) might be involved in growth regulation and myelinization in the peripheral nervous system.
Database Links
Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.