Recombinant Bovine Peroxisomal membrane protein 11A (PEX11A)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX11A; Peroxisomal membrane protein 11A; Peroxin-11A; Peroxisomal biogenesis factor 11A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
PEX11A
Target Protein Sequence
MDAFIRFTNQTQGRDRLFRATQYTCMLLRYLLEPKADNEKVVMKLKKLESSVSTGRKWFR
LGNVVHALQATQQSVRATDLVPRICLTLASLNRVIYFICDTVLFVRSTGLASGVNKEKWR
RWAARYYYYSLLLSLVRDLYEVSLQMKQVAHDRAKREKSPSQDTLGYSVADEETEWLQSL
LLLLFHSLKRHPPLFLDTVKNFCDILNPLDQLGIYKSNPGIIGLGGLVSSVAGIITVAYP
QMKLKTQ
Uniprot No.
Target Background
Function
Recombinant Bovine Peroxisomal membrane protein 11A (PEX11A) may be involved in peroxisomal proliferation and the regulation of peroxisome division. It may mediate the binding of coatomer proteins to the peroxisomal membrane and promote membrane protrusion and elongation on the peroxisomal surface.
Database Links
Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
