Recombinant Bovine Peroxisomal membrane protein 11B (PEX11B)

Shipped with Ice Packs
In Stock

Description

Introduction

Peroxisomal membrane proteins, including Recombinant Bovine Peroxisomal membrane protein 11B (PEX11B), play a crucial role in peroxisome proliferation by regulating the elongation, constriction, and division of pre-existing peroxisomes . Peroxisomes are essential organelles in eukaryotic cells that perform complex metabolic and catabolic functions vital for normal growth and development .

Gene and Protein Structure

PEX11B, also known as Peroxisomal Biogenesis Factor 11 Beta, is a gene that encodes a protein involved in peroxisome biogenesis . The protein encoded by this gene belongs to the PEX11 family, which plays a critical role in peroxisome division . The human PEX11B gene (ENSG00000131779) has 3 transcripts (splice variants) and is associated with 5 phenotypes .

Function

PEX11 proteins are unique in their ability to promote peroxisome division . Overexpression of PEX11 proteins promotes peroxisome division even in the absence of peroxisomal metabolic activity . Mouse cells lacking PEX11B display reduced peroxisome abundance, even without peroxisomal metabolic substrates, and are partially deficient in ether lipid synthesis and very long chain fatty acid oxidation . PEX11B affects peroxisome metabolism indirectly, potentially due to altered membrane structure or dynamics .

Role in Neural Differentiation

Loss of PEX11B expression leads to a significant decrease in the expression of peroxisomal-related genes, including ACOX1, PMP70, PEX1, and PEX7, as well as neural tube-like structures and neuronal markers .

Knockdown of PEX11B reduces the expression of neural tube and neuronal markers and peroxisomal-related genes . The relative expression levels of neural progenitor markers SOX1 and PAX6, as well as the neuronal marker TUJ1, are reduced upon PEX11B knockdown . Dox-induced knockdown of PEX11B significantly decreases the expression levels of PEX1, PEX3, PMP70, PEX7, and ACOX1, but not PEX13 .

PEX11B and Peroxisome Biogenesis Disorders (PBD)

Mutations in 14 genes cause a spectrum of peroxisomal diseases in humans . PEX11B has been associated with an atypical peroxisome biogenesis disorder (PBD) . Peroxisome biogenesis disorder 14B (PBD14B) is an autosomal recessive peroxisome biogenesis disorder characterized clinically by mild intellectual disability, congenital cataracts, progressive hearing loss, and polyneuropathy .

PEX11B-Mediated Peroxisomal Proliferation

Pex11p family proteins are essential for peroxisomal fission, but their molecular mechanisms remain largely unknown . Overexpression of Pex11pβ causes substantial vesiculation of peroxisomes in mammalian cells . This vesicle formation depends on dynamin-like protein 1 (DLP1) and mitochondrial fission factor (Mff), as knockdown of these proteins diminishes peroxisomal fission after Pex11pβ overexpression .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag is required, please specify this in your order to facilitate preferential development.
Synonyms
PEX11B; Peroxisomal membrane protein 11B; Peroxin-11B; Peroxisomal biogenesis factor 11B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
PEX11B
Target Protein Sequence
MDAWVRFSAQSQARERLCRAAQYACSLLGHALQKHGASPELQKQIRQLEGHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGVSGGIEPGGPGGPGIPGG GLPQVALKLRLRVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGLV SSILSILTLICPWLRLKP
Uniprot No.

Target Background

Function

Recombinant Bovine Peroxisomal membrane protein 11B (PEX11B) is involved in peroxisomal proliferation. It may regulate peroxisome division by recruiting the dynamin-related GTPase DNM1L to the peroxisomal membrane, promoting membrane protrusion and elongation on the peroxisomal surface.

Database Links

KEGG: bta:506527

STRING: 9913.ENSBTAP00000011022

UniGene: Bt.8473

Protein Families
Peroxin-11 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.