Recombinant Bovine Peroxisomal membrane protein PEX16 (PEX16)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bovine Peroxisomal membrane protein PEX16 (PEX16), also known as peroxin 16, is a protein crucial for the biogenesis of peroxisomes . Peroxisomes are essential organelles in eukaryotic cells that perform various metabolic functions, including fatty acid oxidation and the synthesis of ether lipids . PEX16 is involved in the early stages of peroxisome assembly and can recruit other peroxisomal proteins, such as PEX3 .

Role in Peroxisome Biogenesis

PEX16 plays a significant role in the de novo synthesis of peroxisomes . It acts as a "master" peroxin responsible for initiating peroxisome biogenesis at the ER in mammals . Unlike some other Pex16p proteins, HsPEX16 does not appear to be directly involved in regulating peroxisome division . Instead, it functions as a PMP receptor during the early stages of de novo peroxisome formation at the ER, as well as in mature peroxisomes .

PEX16 and Peroxisome Biogenesis Disorders (PBDs)

Defects in peroxisome assembly, often linked to PEX16 mutations, are associated with the toxic accumulation of very long-chain fatty acids (VLC-FAs), very long-chain polyunsaturated fatty acids (VLC-PUFAs), and branched-chain FAs . These accumulations can lead to severe developmental and neurological dysfunctions, known as peroxisome biogenesis disorders (PBDs), including the fatal Zellweger syndrome . Fibroblasts from PEX16-deficient patients lack peroxisomal structures but can form peroxisomes upon the expression of PEX16 .

Research Findings and Experimental Evidence

  • PEX16 Knockout Studies: Studies using PEX16-knockout (KO) cells derived from mammalian cultured cell lines have shown varied results, with some cells containing fewer enlarged peroxisomes and others lacking peroxisomes entirely .

  • Overexpression Effects: Overexpression of PEX16 in wild-type HeLa cells can lead to the complete loss of peroxisomes or result in cells with fewer and larger peroxisomes .

  • Rescue Experiments: Low-level expression of PEX16 can rescue aberrant peroxisome morphology in PEX16-KO HeLa, HEK293, and CHO-K1 clones .

  • Mutant Studies: Experiments with PEX16 mutants, such as PEX16R176X, have demonstrated that certain mutations can inhibit the de novo formation of peroxisomes .

Data Tables

ExperimentCell TypeObservationReference
PEX16 OverexpressionWild-type HeLa cellsComplete loss of peroxisomes or cells with fewer and larger peroxisomes
PEX16 KnockoutHeLa, HEK293, CHO-K1Aberrant peroxisome morphology, some cells lacking peroxisomes
Low-Level Expression of Wild-Type PEX16PEX16-KO HeLa cellsRescue of aberrant peroxisome morphology
Expression of PEX16ΔN69 (N-terminal deletion)PEX16-KO HeLa cellsRescue of aberrant peroxisomal morphology, less efficient formation of mature peroxisomes compared to wild-type PEX16
Expression of PEX16R176X (ZS mutant)PEX16/PEX3-DKO HeLaDecreased number of cells forming PMP70-positive structures, inhibition of de novo peroxisome biogenesis

Trafficking of PEX3 via the ER

PEX16 contributes to peroxisome maintenance by constantly trafficking PEX3 via the ER . In mammalian cells, the import of PEX3 relies on HsPEX16, highlighting PEX16's role as a receptor for PEX3 at both the ER and peroxisomes .

Role in Adipocyte Development and Lipid Metabolism

PEX16 plays a critical role in adipocyte development and lipid metabolism . It is essential for peroxin 16 (PEX16)-mediated peroxisome biogenesis in white adipocytes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX16; Peroxisomal membrane protein PEX16; Peroxin-16; Peroxisomal biogenesis factor 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-328
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
PEX16
Target Protein Sequence
MEKLRLLGLRYQEYVTRHPAATAQLETAVRGLSYLLAGRFADSHELSELVYSASNLLVLL NDGILRKELRKKLPMSLSQQRLLTWLSVLECVEVFMEMGATKVWGEVGRWLVIALIQLAK AVLRMFLLIWFKAGLQTSPPIVPLDREIQAQSRDGDHSSGSQEQSYVGKRSNRVVRTLQN TPSLHSRHWGAPQQREELGVAPTPLGLQETIAESLHIARPLLHLLSLGLWGQRSWTPWLL SGVVDVTSLSLLSDRKGLTRRERLELRRRTILLLYYLLRSPFYDRFSEAKILFLLQLLAD HVPGIGLVTRPLMDYLPNWQKIYFYSWG
Uniprot No.

Target Background

Function

PEX16 is essential for peroxisome membrane biogenesis and may play a crucial role in the early stages of peroxisome assembly. It facilitates the recruitment of other peroxisomal proteins, such as PEX3 and PMP34, to de novo peroxisomes originating from the endoplasmic reticulum (ER). PEX16 may also function as a receptor for PEX3.

Database Links
Protein Families
Peroxin-16 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is PEX16 and what is its primary role in peroxisome biogenesis?

PEX16 is an essential peroxisomal membrane protein (PMP) that plays a critical regulatory role in peroxisome biogenesis. It functions as a key peroxin involved in the recruitment of other peroxisomal membrane proteins to the endoplasmic reticulum (ER) and peroxisomal membranes. PEX16 is particularly important for the initial stages of peroxisome formation .

Research has established that PEX16 serves as a receptor for the insertion of PEX3 into membranes, with PEX3 subsequently acting as a docking receptor for PEX19-bound PMPs. This cascade is essential for the de novo formation of peroxisomes from the ER .

Methodologically, to study PEX16's role in peroxisome biogenesis, researchers often employ:

  • Genetic knockout/knockdown studies using siRNA or CRISPR-Cas9

  • Fluorescence microscopy with tagged PEX16 constructs

  • Complementation assays in PEX16-deficient cell lines

  • Co-immunoprecipitation studies to identify interaction partners

How does PEX16 function differ between bovine models and other species?

PEX16 exhibits significant functional diversity across species, which is important to consider when working with the bovine recombinant protein:

SpeciesPrimary PEX16 FunctionLocalizationKey Characteristics
BovineSimilar to human PEX16 (ER-dependent peroxisome biogenesis)ER and peroxisomesContains predicted transmembrane domains
HumanReceptor for PEX3; mediates de novo peroxisome formationER and peroxisomesContains two transmembrane domains; inserted into ER co-translationally
Yarrowia lipolytica (yeast)Critical for peroxisome divisionPeripheral membrane proteinActs in peroxisome fission rather than de novo formation
Arabidopsis thalianaInvolved in de novo peroxisome formationER and peroxisomesMutants show defects in other ER-derived organelles (oil/protein bodies)
Metarhizium robertsii (fungus)Required for de novo peroxisome biogenesisPeroxisome membranesDeletion abolishes peroxisome formation

When working with bovine PEX16, researchers should consider these interspecies differences, especially when designing complementation experiments or structure-function studies .

What are the common expression systems for producing recombinant bovine PEX16?

Several expression systems can be used to produce recombinant bovine PEX16, each with advantages and limitations:

E. coli Expression System:

  • Most commonly used for recombinant bovine PEX16 production

  • Advantages: High yield, cost-effective, rapid expression

  • Limitations: Potential improper folding of membrane proteins, lack of post-translational modifications

  • Methodology: Typically expressed with fusion tags (His, GST) to facilitate purification

Mammalian Expression Systems:

  • Provides proper folding and post-translational modifications

  • Can be achieved using transient transfection or stable cell lines

  • Useful for functional studies and protein-protein interaction analyses

  • Often employs retroviral expression systems for effective delivery

Insect Cell Systems:

  • Baculovirus expression provides higher yields than mammalian systems

  • Maintains proper protein folding and most post-translational modifications

  • Useful for structural studies requiring larger protein quantities

For optimal expression and purification, consider:

  • Using codon-optimized sequences for the expression host

  • Including appropriate fusion tags for detection and purification

  • Adding protease inhibitors during extraction to prevent degradation

  • Employing detergent screening to identify optimal solubilization conditions for this membrane protein

What are the structural characteristics of bovine PEX16?

Bovine PEX16 shares key structural features with its human counterpart, which includes:

  • Protein class: Integral membrane protein with predicted transmembrane domains

  • Molecular weight: Approximately 38-39 kDa (observed in Western blotting)

  • Topology: Both N and C termini likely face the cytosol (based on human PEX16 data)

  • Functional domains: Contains regions mediating:

    • ER targeting and insertion

    • Peroxisomal membrane protein recruitment

    • Trafficking from ER to peroxisomes

When designing experiments with recombinant bovine PEX16, consider:

  • Preserving the integrity of transmembrane domains during expression and purification

  • Including appropriate tags that don't interfere with membrane insertion

  • Using detergent conditions that maintain native protein conformation

  • Validating proper folding using circular dichroism or limited proteolysis

What molecular mechanisms underlie PEX16-mediated recruitment of peroxisomal proteins to the ER?

PEX16 functions as a critical receptor for recruiting peroxisomal membrane proteins (PMPs) to the ER during the early stages of peroxisome biogenesis. The mechanism involves:

  • Initial ER targeting: PEX16 is inserted into the ER membrane via a co-translational SEC61-dependent pathway in mammals

  • PEX3 recruitment: PEX16 serves as a receptor for PEX3 at the ER in a PEX19-independent manner

    • This represents a critical first step in establishing peroxisome formation sites

  • Cascade recruitment: Once PEX3 is integrated into the membrane, it functions as a docking receptor for PEX19-cargo complexes containing other PMPs (group I PMPs)

  • Pre-peroxisome formation: These PEX16-enriched membrane domains develop into pre-peroxisomes that can:

    • Bud from the ER as vesicular structures

    • Form lamellar extensions that detach from the ER

Methodologically, researchers can investigate these mechanisms using:

  • Fluorescence recovery after photobleaching (FRAP) to measure protein dynamics

  • Proximity labeling techniques (BioID, APEX) to identify interacting proteins

  • Live-cell imaging with photoactivatable GFP fusions to track trafficking pathways

  • In vitro reconstitution assays with purified components to assess direct interactions

Recent studies suggest that PEX16 may contain multiple domains mediating different aspects of this process, with distinct regions involved in ER targeting, PMP recruitment, and subsequent trafficking .

How can researchers effectively design mutation studies to identify critical functional domains in bovine PEX16?

Designing comprehensive mutation studies for bovine PEX16 requires systematic approaches to identify domains critical for different functions:

Methodological approach:

  • Domain prediction analysis:

    • Use bioinformatic tools to predict transmembrane domains, conserved motifs, and potential functional regions

    • Perform sequence alignment across species to identify evolutionarily conserved regions

  • Systematic mutation strategy:

    • Design mutations targeting:

      • Predicted transmembrane domains

      • Conserved cytosolic regions

      • ER targeting signals

      • Regions implicated in PMP recruitment

    • Create both point mutations (to identify critical residues) and truncation mutants (to define functional domains)

  • Functional complementation assays:

    • Express mutant constructs in PEX16-deficient cells

    • Assess rescue of peroxisome formation using peroxisomal markers

    • Quantify peroxisome number, size, and morphology

  • Protein-protein interaction analysis:

    • Use co-immunoprecipitation to assess interaction with PEX3 and other partners

    • Employ proximity labeling techniques to identify interaction domains

    • Perform in vitro binding assays with purified components

Previous studies have identified that mutations in different domains affect distinct aspects of PEX16 function. For example, mutations that prevent ER targeting abolish all PEX16 functions, while mutations in PMP recruitment domains may still allow PEX16 localization but prevent peroxisome formation .

What methodologies are most effective for studying PEX16 trafficking between the ER and peroxisomes?

Studying the dynamic trafficking of PEX16 between cellular compartments requires sophisticated imaging and biochemical approaches:

Advanced imaging approaches:

  • Pulse-chase imaging with photoactivatable fluorescent proteins:

    • Tag PEX16 with photoactivatable GFP (PA-GFP)

    • Activate the fluorophore in specific cellular regions (ER or peroxisomes)

    • Track the movement of activated molecules over time

    • This approach has been successfully used to demonstrate de novo peroxisome formation from the ER

  • Correlative light and electron microscopy (CLEM):

    • Identify PEX16-containing structures by fluorescence microscopy

    • Examine the same structures at ultrastructural resolution by electron microscopy

    • Allows visualization of membrane dynamics during pre-peroxisome formation

  • Super-resolution microscopy:

    • Techniques like PALM, STORM, or STED provide resolution below the diffraction limit

    • Can resolve sub-peroxisomal structures and protein distributions

    • Useful for studying the early stages of peroxisome biogenesis

Biochemical and genetic approaches:

  • Cell fractionation combined with immunoblotting:

    • Separate ER and peroxisomal fractions using gradient centrifugation

    • Detect PEX16 distribution using specific antibodies

    • Monitor changes in distribution following cellular perturbations

  • Trafficking signal mutation analysis:

    • Identify potential trafficking signals through systematic mutagenesis

    • Assess how mutations affect steady-state localization and trafficking kinetics

  • Conditional expression systems:

    • Use inducible promoters to control PEX16 expression timing

    • Monitor the progression of PEX16 localization from synthesis to steady-state

Research has shown that PEX16 contains distinct signals for ER targeting and subsequent trafficking to peroxisomes, and these can be experimentally distinguished through careful mutagenesis studies .

How do PEX16 mutations affect peroxisome biogenesis and what disease models are available?

PEX16 mutations have significant implications for peroxisome biogenesis and are associated with human disease:

Pathophysiology of PEX16 mutations:

  • Complete loss-of-function mutations:

    • Result in the absence of peroxisomal structures

    • Cause severe Zellweger syndrome spectrum disorders

    • Associated with profound neurological defects, dysmorphic features, and early mortality

  • Partial loss-of-function mutations:

    • Allow residual peroxisome formation

    • Associated with milder phenotypes including leukodystrophy, spastic paraplegia, cerebellar ataxia, and craniocervical dystonia

    • Recent examples include the variants p.(Ala220Thr) and p.(Arg277Gln)

Research models available:

  • Cellular models:

    • PEX16-deficient human fibroblasts from patients

    • CRISPR-engineered PEX16 knockout cell lines

    • siRNA knockdown models

    • Patient-derived olfactory-neurosphere cells

  • Animal models:

    • Drosophila Pex16 mutants with tissue-specific rescue constructs

    • Studies show dramatic loss of Pex3 puncta in Pex16 mutants

    • Models allow testing of different human PEX16 variants for rescue capacity

  • Yeast models:

    • Although S. cerevisiae lacks a PEX16 homolog, other fungi such as Y. lipolytica and P. chrysogenum can be used

    • P. chrysogenum pex16 deletion mutants show partially functional peroxisomes

When studying bovine PEX16, researchers can use these disease models to:

  • Test the ability of bovine PEX16 to complement defects in human or yeast cells

  • Assess the conservation of function across species

  • Identify critical domains through cross-species complementation studies

PEX16 VariantDisease AssociationCellular PhenotypeRescue Capability
Wild-typeNormalNormal peroxisome formationComplete rescue
p.(Ala220Thr)Leukodystrophy, ataxiaReduced peroxisome density, increased sizePartial rescue
p.(Arg277Gln)Leukodystrophy, ataxiaReduced peroxisome density, increased sizePartial rescue
Truncation mutantsZellweger syndromeAbsence of peroxisomesNo rescue
p.F332DelAtypical ataxiaVaries by assayComparable to wild-type in some assays

What techniques can be used to assess PEX16-mediated protein-protein interactions in peroxisome biogenesis?

Investigating PEX16 interactions requires specialized techniques to account for its membrane localization:

In vivo interaction methods:

  • Proximity labeling techniques:

    • BioID: Fuse PEX16 to a promiscuous biotin ligase (BirA*) to biotinylate proximal proteins

    • APEX2: Fuse PEX16 to an engineered peroxidase that catalyzes biotinylation of nearby proteins

    • These methods identify the PEX16 "interactome" in living cells

    • Particularly valuable for capturing transient interactions

  • Förster Resonance Energy Transfer (FRET):

    • Tag PEX16 and potential partners with appropriate fluorophore pairs

    • Measure energy transfer as evidence of protein proximity

    • Can be performed in living cells to monitor dynamic interactions

  • Split-fluorescent protein complementation:

    • Fuse PEX16 and potential interactors to complementary fragments of a fluorescent protein

    • Interaction brings fragments together, reconstituting fluorescence

    • Allows visualization of interaction sites within cells

Biochemical approaches:

  • Co-immunoprecipitation with membrane-compatible detergents:

    • Solubilize membranes using detergents like digitonin or CHAPS

    • Immunoprecipitate PEX16 using specific antibodies

    • Identify co-precipitating proteins by Western blotting or mass spectrometry

  • Crosslinking approaches:

    • Use membrane-permeable crosslinkers to stabilize transient interactions

    • MS-compatible crosslinkers allow identification of interaction sites

    • Particularly useful for capturing weak or transient interactions

  • In vitro binding assays:

    • Express and purify recombinant PEX16 and potential partners

    • Perform pull-down assays using purified components

    • Determine binding parameters using surface plasmon resonance or microscale thermophoresis

Research has established that PEX16 interacts directly with PEX3, and this interaction is critical for recruiting PEX3 to the ER during the early stages of peroxisome biogenesis . Additional interactions with other peroxins and PMPs continue to be discovered using these techniques.

How can researchers assess the functional impact of PEX16 manipulation on cellular metabolism?

PEX16 function affects peroxisome biogenesis and consequently impacts peroxisomal metabolic pathways. Several approaches can assess these metabolic consequences:

Lipid metabolism analysis:

  • Fatty acid β-oxidation assays:

    • Measure oxidation of radioactively labeled fatty acid substrates

    • Analyze acylcarnitine profiles using mass spectrometry

    • Assess cellular respiration rates using Seahorse analyzers

    • These parameters are altered in PEX16-deficient cells due to impaired peroxisomal β-oxidation

  • Lipidomic analysis:

    • Quantify very long-chain fatty acids (VLCFAs) using GC-MS or LC-MS

    • Analyze plasmalogen levels as indicators of peroxisome function

    • Measure lipid droplet dynamics using fluorescent lipid dyes

Peroxisome-dependent metabolic pathways:

  • Reactive oxygen species (ROS) metabolism:

    • Measure hydrogen peroxide production/degradation

    • Assess activity of peroxisomal catalase

    • Quantify oxidative stress markers

  • Bile acid synthesis intermediates:

    • Analyze bile acid precursors by mass spectrometry

    • Altered in conditions with peroxisomal dysfunction

Functional readouts in specific model systems:

  • Adipocyte differentiation and function:

    • PEX16 silencing in 3T3-L1 cells impacts adipocyte development

    • Assess lipid accumulation using Oil Red O staining

    • Measure adipocyte-specific gene expression

  • Fungal appressorium development:

    • In Metarhizium robertsii, PEX16 deletion impairs turgor pressure generation

    • Decreased glycerol production due to impaired lipid metabolism

    • Assay by measuring glycerol content and appressorium function

  • Antibiotic production in Penicillium:

    • PEX16 deletion in Penicillium chrysogenum reduces penicillin production by ~51%

    • Assess using bioassays with Micrococcus luteus as indicator strain

    • Effects appear independent of penicillin biosynthetic enzyme levels

Research shows that PEX16 dysfunction affects cellular metabolism through impaired peroxisome formation, leading to defects in fatty acid metabolism, ROS handling, and specialized metabolic functions in different cell types .

What are the current challenges and solutions in producing functionally active recombinant bovine PEX16?

Producing functionally active recombinant bovine PEX16 presents several challenges due to its nature as an integral membrane protein:

Key challenges and solutions:

  • Membrane protein solubility:

    • Challenge: PEX16 contains transmembrane domains that make it prone to aggregation during expression

    • Solutions:

      • Use fusion partners that enhance solubility (MBP, SUMO, TrxA)

      • Express truncated versions containing specific functional domains

      • Screen multiple detergents for optimal solubilization

      • Consider nanodiscs or amphipols for maintaining native conformation

  • Proper folding and post-translational modifications:

    • Challenge: E. coli systems may not provide proper folding environment

    • Solutions:

      • Use eukaryotic expression systems (insect cells, mammalian cells)

      • Express in cell-free systems supplemented with microsomes

      • Consider co-expression with chaperones

      • Use peroxisome-deficient mammalian cell lines for expression

  • Functional validation:

    • Challenge: Assessing whether recombinant PEX16 retains native activity

    • Solutions:

      • Develop complementation assays in PEX16-deficient cells

      • Assess protein-protein interactions with known partners (PEX3)

      • Verify proper subcellular targeting using fluorescently tagged constructs

      • Use in vitro reconstitution systems with artificial membranes

  • Stability during purification:

    • Challenge: Maintaining protein stability throughout purification

    • Solutions:

      • Optimize buffer conditions (pH, salt concentration, glycerol)

      • Include stabilizing ligands during purification

      • Use mild detergents and minimize temperature fluctuations

      • Consider on-column folding strategies

  • Expression level optimization:

    • Challenge: Achieving sufficient yield for structural and biochemical studies

    • Solutions:

      • Use codon-optimized sequences for the expression host

      • Test multiple promoters and induction conditions

      • Consider directed evolution approaches to select for highly-expressed variants

      • Use fusion tags that can be monitored during expression optimization

When working with recombinant bovine PEX16, researchers should validate that the protein:

  • Localizes correctly to the ER and/or peroxisomes when expressed in cells

  • Interacts with known binding partners like PEX3

  • Complements PEX16 deficiency in appropriate cell models

  • Maintains expected biochemical properties throughout purification

How can researchers optimize Western blotting protocols for detecting recombinant bovine PEX16?

Western blotting of PEX16 requires specific considerations due to its membrane protein nature and expression characteristics:

Sample preparation optimization:

  • Effective membrane protein extraction:

    • Use detergent mixtures optimized for membrane proteins (e.g., 1% Triton X-100 with 0.1% SDS)

    • Consider specialized membrane protein extraction kits

    • Include protease inhibitors to prevent degradation

    • Avoid excessive heating which can cause aggregation

  • Subcellular fractionation approaches:

    • Separate cytosolic, ER, and peroxisomal fractions before analysis

    • Enriches target protein and provides localization information

    • Use differential centrifugation combined with density gradients

Western blotting protocol refinements:

  • Gel system selection:

    • Use gradient gels (4-15% or 4-20%) for better resolution of the 38-39 kDa PEX16 protein

    • Consider Tricine-SDS-PAGE for improved membrane protein separation

    • Use transfer conditions optimized for membrane proteins (lower voltage, longer time)

  • Blocking optimization:

    • Test BSA-based blocking buffers vs. milk-based alternatives

    • Consider commercial membrane protein-specific blocking buffers

    • Optimize blocking time and temperature

  • Antibody selection and optimization:

    • Commercial anti-PEX16 antibodies have been validated for human, mouse, and rat samples

    • Dilution ranges of 1:500-1:2000 are typically effective

    • For recombinant bovine PEX16, verify cross-reactivity or use tag-specific antibodies

    • Consider long primary antibody incubation at 4°C overnight

  • Signal detection optimization:

    • Use high-sensitivity ECL substrates for low-abundance proteins

    • Consider fluorescent secondary antibodies for quantitative analysis

    • Optimize exposure times for different detection systems

Validation and controls:

  • Positive controls:

    • Include human liver tissue or HepG2 cell lysates as positive controls

    • Use previously validated recombinant PEX16 preparations

  • Specificity controls:

    • Use PEX16-deficient cell lysates as negative controls

    • Perform peptide competition assays to confirm antibody specificity

    • Include tag-only expression controls when using tagged recombinant proteins

  • Loading controls:

    • Use membrane protein-specific loading controls (e.g., calnexin for ER fractions)

    • Consider total protein staining methods (Ponceau S, REVERT)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.