Recombinant Bovine Peroxisome assembly protein 12 (PEX12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
PEX12; Peroxisome assembly protein 12; Peroxin-12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
PEX12
Target Protein Sequence
MAEHGAHITTASVVDDQPSIFEVVAQDSLMSAVRPALQHVVKVLAESNPAHFGFFWRWFD EIFTLLDLLLQQHYLSKTSASFSENFYGLKRIVMGDQHKLQRLANAGLPKQQFMKSIMFL VLLPYLKVKLEKLVSSLREEDEYSIHPPSSRWKRFYRAFLAAYPFVNMAWEGWFLVQQLR YILGKAQHHSPLLRLAGVRLGRLTVQDIQALEHKPAEASMMQLPAGSIGEKIKSALKKAV GGVALSLSTGLSVGVFFLQFLEWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKM KTVCPLCRKNRVNDTVLATSGYVFCYRCVFHYVRSHQACPITGYPTEVQHLIKLYSPEN
Uniprot No.

Target Background

Function
Essential for protein import into peroxisomes.
Database Links

KEGG: bta:506007

STRING: 9913.ENSBTAP00000026285

UniGene: Bt.7155

Protein Families
Pex2/pex10/pex12 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of bovine PEX12 protein?

PEX12 is an integral peroxisomal membrane protein characterized by a zinc ring domain at its carboxy terminus. Structurally, PEX12 spans the peroxisome membrane twice, with both its N-terminal and C-terminal regions extending into the cytoplasm . The C-terminal zinc-binding domain is particularly important for PEX12 function and contains critical cysteine residues that coordinate zinc ions. This domain mediates protein-protein interactions that are essential for peroxisome biogenesis . The zinc ring domain structure is conserved across species, suggesting functional importance in the evolutionary context of peroxisomal proteins.

What are the primary molecular functions of PEX12?

PEX12 serves multiple critical functions in peroxisome biogenesis:

  • It interacts directly with the PTS1 receptor PEX5 via its zinc-binding domain, functioning downstream of receptor docking in the peroxisomal matrix protein import pathway .

  • PEX12 forms a complex with PEX10, another integral peroxisomal membrane protein containing a zinc ring domain, creating a functional unit involved in peroxisomal matrix protein import .

  • PEX12 functions as a protein-ubiquitin ligase (E3) facilitating the ubiquitination of the import receptor PEX5, specifically participating in Pex4-dependent monoubiquitination of PEX5 .

  • It plays a role in the recycling of PEX5 from the peroxisomal membrane back to the cytosol, a critical step in the protein import cycle .

These functions collectively contribute to proper peroxisome biogenesis and maintenance, with loss of PEX12 function leading to severe peroxisomal disorders.

How does bovine PEX12 compare with human and other mammalian PEX12 proteins?

While the search results don't directly compare bovine PEX12 with other species, functional studies of PEX12 across species indicate conservation of key domains and interactions. The zinc-binding domain of PEX12 appears to be functionally conserved across mammals, as evidenced by similar interaction patterns with PEX5 and PEX10 . Researchers investigating bovine PEX12 should consider sequence alignments with human and other mammalian PEX12 proteins to identify conserved residues, especially within the functionally critical zinc-binding domain.

When designing experiments with recombinant bovine PEX12, consideration of species-specific variations may be important for interaction studies, particularly if using binding partners from different species. Comparative analysis may reveal subtle differences in binding affinities or regulatory mechanisms that could be physiologically relevant.

What expression systems are optimal for producing recombinant bovine PEX12?

For recombinant bovine PEX12 expression, several systems may be considered based on the research performed with human and yeast PEX12:

  • Bacterial expression systems: E. coli has been used to express the C-terminal domain of PEX12 as fusion proteins with maltose-binding protein (MBP). This approach was successfully employed for the zinc-binding domain of human PEX12 to study protein-protein interactions . Full-length PEX12 may be challenging to express in bacterial systems due to its transmembrane domains.

  • Yeast expression systems: Considering that PEX12 has been studied in yeast models such as Pichia pastoris, yeast expression systems may provide proper folding and post-translational modifications for recombinant bovine PEX12 .

  • Mammalian cell expression: For studies requiring fully functional bovine PEX12 with native post-translational modifications, mammalian cell expression systems (CHO or HEK293) would be more appropriate, particularly for interaction studies with mammalian binding partners.

When designing expression constructs, researchers should consider including epitope tags (e.g., myc, HA) that have been successfully used for detection and immunoprecipitation studies with human PEX12 .

What purification challenges are specific to recombinant bovine PEX12 and how can they be addressed?

Purification of full-length recombinant bovine PEX12 presents several challenges due to its membrane-associated nature:

  • Solubilization strategy: Optimal detergent selection is critical. Consider a panel of detergents including mild non-ionic detergents (DDM, CHAPS) for initial screening to maintain protein structure and function.

  • Maintaining zinc binding: The functional zinc-binding domain requires special consideration during purification. Include zinc in buffers (typically 10-50 μM ZnCl₂) to maintain the integrity of the zinc finger domain.

  • Protein stability: PEX12 may form complexes with other peroxins when expressed in eukaryotic systems. Consider whether to disrupt or preserve these interactions based on experimental goals.

  • Purification of functional domains: For interaction studies, expressing and purifying just the C-terminal zinc-binding domain (as demonstrated with human PEX12) may circumvent some challenges of full-length protein purification .

Based on previous work with human PEX12, affinity tags such as MBP have been successfully used for the zinc-binding domain . For full-length protein, a dual tag approach might be beneficial for achieving higher purity.

How can researchers verify the structural integrity of purified recombinant bovine PEX12?

After purification, verifying the structural integrity of recombinant bovine PEX12 is essential. Several approaches are recommended:

  • Zinc content analysis: Quantify zinc content using atomic absorption spectroscopy or colorimetric assays to confirm proper zinc incorporation in the C-terminal domain.

  • Circular dichroism (CD) spectroscopy: Assess secondary structure elements and proper folding, particularly important for the zinc-binding domain.

  • Functional binding assays: Validate protein functionality through binding assays with known interaction partners such as PEX5 and PEX10. Blot overlay assays have been successfully used to demonstrate binding between the zinc-binding domain of PEX12 and its partners .

  • Thermal shift assays: Determine protein stability and the effect of different buffer conditions on protein folding.

  • Size exclusion chromatography: Assess protein homogeneity and potential aggregation states.

These methods collectively provide a comprehensive assessment of recombinant bovine PEX12 structural integrity before proceeding to functional studies.

What methods are most effective for studying PEX12 interactions with other peroxins?

Multiple complementary approaches have proven effective for studying PEX12 interactions:

  • Yeast two-hybrid system: Successfully used to detect interactions between the zinc-binding domain of PEX12 and both PEX5 and PEX10 . This system is particularly useful for initial screening of potential interaction partners.

  • In vitro binding assays: Blot overlay assays using recombinant proteins have confirmed direct physical interactions between PEX12 and its binding partners . For example, MBP-PEX12 fusion proteins immobilized on membranes were probed with radiolabeled PEX5 or PEX10 to demonstrate specific binding .

  • Co-immunoprecipitation: This approach has verified PEX12 interactions in cellular contexts. Epitope-tagged versions of PEX12 (e.g., myc-tagged) and potential binding partners (e.g., HA-tagged PEX10) have been successfully used to demonstrate complex formation in vivo .

  • Bioluminescence resonance energy transfer (BRET) or fluorescence resonance energy transfer (FRET): These techniques can assess protein-protein interactions in living cells and may be valuable for studying dynamic interactions involving bovine PEX12.

  • Surface plasmon resonance (SPR): For quantitative binding analysis, including determination of association and dissociation constants for PEX12 interactions.

The combination of these methods provides robust validation of protein interactions and can reveal both static and dynamic aspects of PEX12 function.

How can researchers assess the E3 ubiquitin ligase activity of bovine PEX12?

To evaluate the E3 ubiquitin ligase activity of bovine PEX12, researchers can employ the following approaches:

  • In vitro ubiquitination assays: Reconstitute the ubiquitination reaction with purified components including recombinant bovine PEX12 (particularly the zinc-binding domain), E1 enzyme, appropriate E2 enzymes (Pex4 for monoubiquitination and Ubc4 for polyubiquitination), ubiquitin, ATP, and substrate (typically PEX5) .

  • Analysis of ubiquitination patterns: Use western blotting to detect different ubiquitination states of PEX5. PEX12 has been shown to facilitate Pex4-dependent monoubiquitination of PEX5, which can be distinguished from Pex2-mediated polyubiquitination .

  • RING domain mutant controls: Create mutations in the zinc-binding RING domain as negative controls. Specific cysteine residues critical for zinc coordination can be mutated to disrupt E3 ligase activity.

  • Cell-based ubiquitination assays: Express recombinant bovine PEX12 in mammalian cells along with tagged ubiquitin and PEX5, then immunoprecipitate PEX5 to assess its ubiquitination status.

When conducting these assays, it is important to include controls that distinguish PEX12-specific activity from other E3 ligases that may be present in the experimental system.

What functional complementation assays can be used to study bovine PEX12 activity?

Functional complementation assays provide powerful tools to assess PEX12 activity in cellular contexts:

  • Genetic complementation in PEX12-deficient cell lines: Human fibroblasts from patients with PEX12 mutations have been successfully used for complementation studies . Transfection of these cells with bovine PEX12 followed by assessment of peroxisomal matrix protein import (e.g., catalase) can determine functional conservation.

  • High-dosage suppression assays: The biological significance of PEX12 interactions can be tested through suppression assays. For example, overexpression of PEX12 has been shown to suppress certain PEX10 mutations, confirming the functional relevance of their interaction .

  • Domain swapping experiments: Creating chimeric proteins between bovine and human or yeast PEX12 can identify species-specific functional domains and conserved regions.

  • Point mutation analysis: Introduction of specific mutations (particularly in the zinc-binding domain) can help map functional residues. For example, the S320F mutation in human PEX12 reduces binding to both PEX5 and PEX10, affecting function .

The results of these complementation assays can be quantified by measuring the percentage of cells showing restored peroxisomal protein import or by biochemical assays of peroxisomal enzyme activities.

How does bovine PEX12 function in the context of the peroxisomal importomer complex?

PEX12 functions as part of a larger protein complex involved in peroxisomal matrix protein import:

  • Role in the RING peroxin complex: PEX12 interacts with other RING-domain peroxins, particularly PEX10, forming a functional unit at the peroxisomal membrane . This complex plays a critical role downstream of receptor docking in the import pathway.

  • Functional division of labor: Within the peroxisomal importomer, different RING peroxins appear to have specialized functions. PEX12 facilitates Pex4-dependent monoubiquitination of PEX5, while PEX2 mediates Ubc4-dependent polyubiquitination . This functional specialization suggests coordinated activity within the importomer complex.

  • Sequential protein interactions: PEX12 interacts with PEX5 after the receptor has docked at the peroxisomal membrane but is not involved in the docking process itself . This indicates that PEX12 functions in later stages of the import cycle, potentially in receptor recycling.

  • Interplay with AAA-ATPases: The PEX1/PEX6 AAA-ATPase complex functions in concert with RING peroxins to extract ubiquitinated PEX5 from the peroxisomal membrane . Understanding how bovine PEX12 coordinates with these energy-providing components would provide insight into the complete import mechanism.

Advanced imaging techniques such as super-resolution microscopy could help visualize the spatial organization of PEX12 within the importomer complex in bovine cells.

What structural biology approaches can provide insights into bovine PEX12 function?

Several structural biology approaches could advance understanding of bovine PEX12:

  • X-ray crystallography: Determining the crystal structure of the zinc-binding domain of bovine PEX12 would provide atomic-level insights into its interaction interfaces. This approach may require co-crystallization with binding partners like PEX5 or PEX10 for stable crystal formation.

  • Cryo-electron microscopy (cryo-EM): This technique could reveal the structure of larger complexes involving PEX12, such as the RING peroxin complex or PEX12 in association with the membrane.

  • NMR spectroscopy: For studying the solution structure and dynamics of the zinc-binding domain, particularly how it changes upon interaction with binding partners.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): This approach can map protein-protein interaction interfaces and conformational changes in PEX12 upon binding to partners.

  • Molecular dynamics simulations: Computational approaches can model the dynamic behavior of bovine PEX12 and predict the effects of mutations or binding events.

These structural studies would be particularly valuable for understanding the molecular basis of PEX12 functional specificity and could guide rational design of tools to manipulate its activity.

How do disease-causing mutations in PEX12 affect protein function, and what can be learned from comparative studies with bovine PEX12?

Disease-causing mutations in human PEX12 provide valuable insights into protein function:

  • Genotype-phenotype correlations: Severe defects in PEX12 activity are associated with mutations that truncate the protein upstream of the zinc-binding domain, while milder phenotypes correlate with mutations that preserve this domain . Comparative analysis with bovine PEX12 could reveal whether these critical regions are conserved.

  • Missense mutations in functional domains: The S320F mutation in the zinc-binding domain of human PEX12 reduces binding to both PEX5 and PEX10, directly linking protein interaction capacity with disease severity . Introducing equivalent mutations in bovine PEX12 could determine functional conservation.

  • Suppression mechanisms: Overexpression of either PEX5 or PEX10 can suppress certain PEX12 mutations, suggesting compensatory mechanisms . Similar studies with bovine proteins could reveal species-specific differences in these rescue pathways.

  • Protein stability effects: Some mutations may affect protein stability rather than direct functional interactions. Analysis of protein degradation kinetics for wild-type and mutant bovine PEX12 could provide insights into quality control mechanisms.

This type of comparative analysis between human disease mutations and equivalent positions in bovine PEX12 could both enhance understanding of PEX12 function and potentially identify novel therapeutic approaches for peroxisomal disorders.

What are common technical challenges when working with recombinant bovine PEX12 and how can they be overcome?

Researchers working with recombinant bovine PEX12 may encounter several technical challenges:

  • Low expression levels: Membrane proteins often express poorly. Solutions include optimizing codon usage for the expression system, using stronger promoters, or expressing just functional domains (like the zinc-binding domain) .

  • Protein misfolding: The zinc-binding domain requires proper zinc coordination for folding. Include zinc in growth media and purification buffers, and consider fusion partners that enhance solubility (MBP has been successfully used with human PEX12) .

  • Aggregation during purification: Progressive detergent screening is recommended, starting with milder detergents. Consider purifying at lower temperatures (4°C) and including glycerol (10-15%) in purification buffers.

  • Variability in functional assays: Standardize cell-based assays by using stable cell lines rather than transient transfections when possible. For in vitro assays, ensure consistent protein quality between preparations through rigorous quality control.

  • Verifying proper subcellular localization: When expressing recombinant bovine PEX12 in mammalian cells, confirm proper peroxisomal localization using immunofluorescence microscopy with peroxisomal markers before conducting functional studies.

Careful optimization of each experimental stage can significantly improve the reliability and reproducibility of results with this challenging protein.

What are the best approaches for detecting and quantifying bovine PEX12 in experimental systems?

Several complementary approaches for detecting and quantifying bovine PEX12 include:

  • Western blotting: If bovine-specific antibodies are unavailable, epitope tagging (myc, FLAG, or HA tags) has been successfully used with human PEX12 . Position tags carefully to avoid interfering with functional domains.

  • Quantitative PCR: For measuring PEX12 mRNA levels in bovine tissues or cells, design primers specific to bovine PEX12 sequences with appropriate controls.

  • Mass spectrometry: For absolute quantification, selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) can be employed with isotopically labeled peptide standards derived from bovine PEX12.

  • Immunofluorescence microscopy: For localization studies, co-staining with established peroxisomal markers can confirm proper targeting of recombinant bovine PEX12.

  • Flow cytometry: If using fluorescent protein fusions, flow cytometry can quantify expression levels across cell populations and identify optimal expression conditions.

Each method has specific advantages, and combining multiple approaches provides more robust quantification and localization data.

What controls are essential for validating experimental results with recombinant bovine PEX12?

Rigorous experimental design for bovine PEX12 studies should include these essential controls:

  • Functional domain mutants: Mutations in the zinc-binding domain (particularly zinc-coordinating cysteines) serve as negative controls for function .

  • Species comparison controls: Include human PEX12 as a reference when studying bovine PEX12 to identify species-specific differences versus technical artifacts.

  • Expression level controls: Since overexpression can cause artifacts, titrate expression levels and include proper loading controls in all experiments.

  • Interaction specificity controls: For binding studies, include unrelated proteins with similar biochemical properties to ensure interactions are specific. The MBP-LacZα fusion has been used as a control for MBP-PEX12 binding studies .

  • Cell line validation: When using PEX12-deficient cell lines for complementation studies, verify the molecular defect and ensure there are no additional mutations affecting the peroxisomal import pathway.

  • Antibody validation: Thoroughly validate antibody specificity using knockout/knockdown controls, especially when working with bovine systems where fewer validated reagents may be available.

Proper controls are essential for distinguishing genuine biological effects from technical artifacts, particularly when working with a challenging membrane protein like PEX12.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.