Recombinant Bovine Phosphate carrier protein, mitochondrial (SLC25A3)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Isoforms

The bovine phosphate carrier (bPiC2) is a 40.1 kDa protein encoded by SLC25A3, featuring six transmembrane helices and cytosolic N-/C-termini . Two isoforms arise from alternative splicing:

  • Isoform A (PiC2A): Expressed in cardiac/skeletal muscle, with higher phosphate affinity .

  • Isoform B (PiC2B): Ubiquitously expressed, exhibits a 3-fold higher maximal Pi transport rate .

Phosphate Transport

Recombinant bPiC2 imports inorganic phosphate (Pi) into mitochondria via proton-coupled symport, critical for ATP synthesis . Key findings include:

  • Kinetics: PiC2B transports Pi at ~300 µmol/min/g protein in reconstituted liposomes, outperforming PiC2A .

  • pH Dependency: Optimal activity at pH 6.8–7.0, aligning with mitochondrial matrix conditions .

Copper Transport

Unexpectedly, recombinant SLC25A3 also transports Cu+ ions:

  • Proteoliposome Assays: Purified bPiC2 mediates Cu+ uptake with a Km of 2.1 µM .

  • Rescue Experiments: Expression in pic2Δ yeast restores cytochrome c oxidase (COX) activity under Cu limitation .

Table 2: Key Studies Using Recombinant SLC25A3

SystemFindingCitation
Lactococcus lactisHeterologous expression induces Cu sensitivity, confirming transport
Yeast (pic2Δ)Rescues COX deficiency via mitochondrial Cu delivery
Liposome ReconstitutionConfirms dual Pi/Cu transport capability
  • Structural Insights: Homology modeling using bovine ADP/ATP carrier (PDB:1OKC) identified conserved residues (e.g., L175) critical for substrate specificity . Mutagenesis (e.g., L175A) ablates Pi transport but retains Cu uptake .

Disease Relevance and Therapeutic Implications

Mutations in SLC25A3 cause mitochondrial phosphate carrier deficiency (MPCD), characterized by lactic acidosis and cardiomyopathy . Recombinant bPiC2 studies have clarified pathogenic mechanisms:

  • Hypertrophic Cardiomyopathy: Slc25a3 knockout mice develop mitochondrial ATP synthesis defects and cardiac hypertrophy .

  • MPTP Regulation: PiC deletion desensitizes the mitochondrial permeability transition pore (MPTP), reducing ischemia-reperfusion injury .

Challenges and Future Directions

  • Substrate Competition: Phosphate levels modulate Cu transport efficiency, complicating in vivo studies .

  • Isoform-Specific Therapies: Targeting PiC2A could treat muscle-specific disorders without systemic effects .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A3; PHC; Phosphate carrier protein, mitochondrial; Phosphate transport protein; PTP; Solute carrier family 25 member 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
50-362
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
SLC25A3
Target Protein Sequence
AVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKSIFNGFSV TLKEDGFRGLAKGWAPTFIGYSLQGLCKFGFYEVFKVLYSNMLGEENAYLWRTSLYLAAS ASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIP YTMMKFACFERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVS VLNKEKGSSASEVLKRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPE MPESLKKKLGYTQ
Uniprot No.

Target Background

Function
This protein facilitates the transport of phosphate groups from the cytosol to the mitochondrial matrix. Phosphate is cotransported with H(+). It may play a role in regulating the mitochondrial permeability transition pore (mPTP).
Database Links

KEGG: bta:282477

STRING: 9913.ENSBTAP00000017131

UniGene: Bt.4880

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and primary function of SLC25A3?

SLC25A3 (also known as PiC) is a member of the mitochondrial carrier family that catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. It contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family . Early homology models suggest SLC25A3 has six transmembrane segments, 3-fold symmetry, and N- and C-termini facing the intermembrane space . As an essential component of the ATP synthasome, SLC25A3 supplies inorganic phosphate required for oxidative phosphorylation .

How can I reconstitute functional SLC25A3 for in vitro studies?

For functional reconstitution of SLC25A3:

  • Express the protein using an appropriate system (E. coli or in vitro wheat germ expression system)

  • Purify using glutathione sepharose 4 fast flow for GST-tagged versions

  • Reconstitute into phospholipid vesicles for transport assays

  • Store in 50mM Tris-HCl, 10mM reduced glutathione, pH 8.0 buffer at -80°C

  • Use within three months of preparation for optimal activity

Both recombinant isoforms A and B can be successfully reconstituted into phospholipid vesicles where they catalyze Pi/Pi antiport and Pi/H+ symport with similar substrate specificity and inhibitor sensitivity profiles .

What are the key differences between SLC25A3 isoforms and how do they impact experimental design?

SLC25A3 has two isoforms (A and B) arising from alternative splicing of exon 3:

CharacteristicSLC25A3-ASLC25A3-B
Expression patternExclusively in cardiac and skeletal muscleUbiquitously expressed in all tissues
Phosphate transport affinity3-fold higherLower
Maximum transport rateLower3-fold higher
Clinical significanceMutations cause muscle-specific disordersLess studied clinically

Researchers should consider these differences when designing experiments with tissue-specific contexts. For cardiac or muscle studies, isoform A is physiologically relevant, while isoform B is appropriate for studies in other tissues . Western blot analysis using isoform-specific antibodies revealed that heart and liver bovine mitochondria contained 69 and 0 pmol of PiC-A/mg of protein, and 10 and 8 pmol of PiC-B/mg of protein, respectively .

How can I specifically detect different SLC25A3 isoforms in experimental samples?

For isoform-specific detection:

  • Use polyclonal site-directed antibodies specific for PiC-A and PiC-B in western blot analysis

  • Design PCR primers targeting the alternatively spliced exon 3 region

  • For protein analysis, look for the 13-amino acid difference between residues 54 and 80

  • Consider tissue source (cardiac/skeletal muscle express predominantly isoform A)

  • Validate detection using recombinant standards of known isoform identity

The sequence divergence between PiC-A and PiC-B has functional significance, making accurate isoform identification critical for interpreting experimental results .

How can I measure SLC25A3 phosphate transport activity in my experimental system?

To measure SLC25A3 phosphate transport:

  • Reconstitute purified protein into phospholipid vesicles

  • Measure transport using radiolabeled phosphate or phosphate analogs (like arsenate)

  • Determine kinetic parameters (Km, Vmax) for both isoforms under standardized conditions

  • Use specific inhibitors to confirm SLC25A3-specific transport

  • Complement measurements with functional assays of mitochondrial energy production

In reconstituted systems, both isoforms A and B catalyze Pi/Pi antiport and Pi/H+ symport with distinct kinetic parameters. Transport affinities of isoform B for phosphate and arsenate are approximately 3-fold lower than those of isoform A, while the maximum transport rate of isoform B is about 3-fold higher .

What is the current understanding of SLC25A3's copper transport function?

Recent research has identified SLC25A3 as a mitochondrial copper (Cu+) transporter:

  • SLC25A3 can transport copper both in vitro and in vivo, importing Cu+ into the mitochondrial matrix

  • SLC25A3 depletion in human and mouse cells causes cytochrome c oxidase (COX) deficiency that can be suppressed by copper supplementation

  • Reduced expression of SLC25A3 contributes to electron leak from mitochondria by limiting Cu availability

  • SLC25A3 contains conserved residues (Cys, Met, His) that could function as copper-binding sites

  • Copper binding experiments show human PiC2A has a binding stoichiometry of 2 Cu+ ions

Interestingly, the initial rate of copper transport is inhibited by a 10-fold excess of arsenate, suggesting potential interaction between phosphate and copper transport mechanisms .

How can I design experiments to study SLC25A3 deficiency models?

To study SLC25A3 deficiency models:

  • Generate knockdown/knockout models using siRNA or CRISPR/Cas9 systems targeting SLC25A3

  • Measure mitochondrial function parameters (membrane potential, oxygen consumption, ATP production)

  • Assess copper transport using fluorescent indicators of mitochondrial copper (e.g., Mito-CS1)

  • Examine reactive oxygen species (ROS) production and expression of antioxidant enzymes

  • Challenge cells with metabolic stressors like oleic acid to reveal conditional defects

SLC25A3-deficient cells (particularly the SLC25A3-A isoform) show reduced mitochondrial ATP synthesis and development of mitochondrial cardiomyopathy similar to that observed in people with mitochondrial phosphate carrier deficiency .

What cellular pathways are affected by SLC25A3 deficiency that could serve as therapeutic targets?

SLC25A3 deficiency affects multiple cellular pathways:

  • Oxidative phosphorylation: Reduced ATP synthesis due to limited phosphate availability

  • Copper homeostasis: Decreased mitochondrial copper availability affecting COX assembly

  • Redox balance: Increased ROS production with reduced expression of glutathione peroxidase (GPX) 1 and glutathione disulfide reductase (GSX)

  • Mitochondrial proteome: SLC25A3 deletion drives cardiac acylome remodeling, affecting a network of mitochondrial proteins

  • Fatty acid metabolism: SLC25A3-deficient cells show increased sensitivity to fatty acid exposure

Potential therapeutic approaches include copper supplementation, which suppresses COX deficiency in SLC25A3-depleted cells, or targeting downstream pathways like antioxidant systems to mitigate increased ROS production .

How can I study the interaction between SLC25A3 and the ATP synthasome complex?

To study SLC25A3's role in the ATP synthasome complex:

  • Use cross-linking approaches to identify proteins in proximity to SLC25A3

  • Perform co-immunoprecipitation studies to identify stable interaction partners

  • Analyze intact complexes using blue native PAGE

  • Study the ATP synthasome containing stoichiometric amounts of ADP/ATP and phosphate carriers associated with ATP synthase

  • Use fluorescence anisotropy to detect interactions between SLC25A3 and binding partners

SLC25A3 is an essential component of the mitochondrial ATP synthasome, and understanding its interactions is critical for comprehending mitochondrial energy production mechanisms .

What experimental approaches can reveal the relationship between SLC25A3's dual functions in phosphate and copper transport?

To investigate the dual transport functions:

  • Perform copper uptake assays with purified and reconstituted SLC25A3 in proteoliposomes

  • Express SLC25A3 in heterologous systems (yeast pic2Δ background or Lactococcus lactis) to study copper transport function

  • Test competition between phosphate (or arsenate) and copper transport

  • Use site-directed mutagenesis to identify residues critical for each transport function

  • Employ fluorescence anisotropy to measure interaction with copper-binding ligands

Research shows that copper supplementation suppresses the COX deficiency phenotype in SLC25A3-depleted cells, and purified SLC25A3 transports copper in the absence of additional accessory factors .

How can I explore the role of SLC25A3 in mitochondrial redox balance and oxidative stress?

To investigate SLC25A3's role in redox balance:

  • Measure ROS production in SLC25A3-deficient versus control cells

  • Analyze expression of antioxidant enzymes (GPX1, GSX) at mRNA and protein levels

  • Assess mitochondrial copper content using appropriate indicators or analytical methods

  • Challenge cells with fatty acids or other metabolic stressors to reveal conditional defects

  • Investigate electron leak from the respiratory chain using specific probes

SLC25A3-deficient cells are prone to produce ROS, with increased oxidative stress associated with reduced expression of antioxidant enzymes. This appears to be linked to limited copper availability, which contributes to electron leak from mitochondria .

What are the optimal conditions for handling recombinant SLC25A3 to maintain functionality?

For optimal handling of recombinant SLC25A3:

  • Store at -80°C in 50mM Tris-HCl, 10mM reduced glutathione, pH 8.0 buffer

  • Use within three months of preparation for best results

  • Avoid repeated freeze-thaw cycles

  • For quality control, assess purity using 12.5% SDS-PAGE stained with Coomassie Blue

  • Verify functionality through transport assays after any manipulation

These conditions have been validated for recombinant SLC25A3 expressed in wheat germ systems, which produces a soluble GST-tagged protein with a theoretical molecular weight of 65.45kDa .

What are the key considerations when designing knockdown/knockout models of SLC25A3?

When designing SLC25A3 knockdown/knockout models:

  • Consider tissue-specific isoform expression (A vs. B) when targeting specific exons

  • For CRISPR/Cas9 approaches, use custom-designed sgRNAs targeting intron/exon junctions

  • Include appropriate controls (e.g., empty plasmid expressing only Cas9 but no sgRNA)

  • Validate knockdown/knockout at both mRNA and protein levels

  • Assess baseline and stress-induced phenotypes, as some defects only manifest under challenge conditions

Researchers have successfully used CRISPR/Cas9 with sgRNAs targeting intron/exon junction 2 of the Slc25a3 gene to generate knockout models for functional studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.