Recombinant Bovine Phosphatidylinositide phosphatase SAC1 (SACM1L)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Bovine Phosphatidylinositide phosphatase SAC1 (SACM1L) is a phosphatase that acts on phosphatidylinositides . It is also known as phosphatidylinositide phosphatase SAC1 . SAC1 is a protein that is expressed in E. coli .

Function and Activity

SAC1 regulates bacterial replication by controlling phosphatidylinositol-4-phosphate (PI(4)P) on Salmonella-containing autophagosomes . Its phosphatase activity is essential for restricting bacterial replication . SAC1 promotes the fusion of Salmonella-containing autophagosomes with lysosomes, which reduces cytosolic bacterial replication .

Production and Sourcing

Recombinant Bovine Phosphatidylinositide phosphatase SAC1 (SACM1L) can be produced in various expression systems, including:

  • Yeast

  • E. coli

  • Baculovirus

  • Mammalian cells

Research Applications

SAC1 antibodies are valuable for detecting and measuring SAC1 antigen in biological samples . SACM1L antibodies are used in applications such as WB (Western blotting), IHC (immunohistochemistry), IF/ICC (immunofluorescence/immunocytochemistry), IP (immunoprecipitation), and ELISA (enzyme-linked immunosorbent assay) . These antibodies show reactivity with human, mouse, and rat samples .

Impact on Bacterial Replication

Studies using SACM1L knockout (KO) cell lines have demonstrated the importance of SAC1 in restricting intracellular bacterial replication . In cells lacking SAC1, robust bacterial replication is observed, confirming that SACM1L KO cells reproduce the SACM1L knockdown phenotype . Re-expression of SAC1 WT protein in SACM1L KO cells restores the restriction of bacterial replication to a level similar to that of WT cells .

SAC1 and Autophagy

SAC1 restricts intracellular bacterial replication through a xenophagy-specific role . Loss of SAC1 does not interfere with non-selective autophagy or lysosomal function, but it does impact the targeting of bacteria by key xenophagy markers . A delay in Salmonella-containing autophagosome maturation in SACM1L KO cells suggests that SAC1 promotes the fusion of these autophagosomes with lysosomes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SACM1L; SAC1; Phosphatidylinositol-3-phosphatase SAC1; Phosphatidylinositol-4-phosphate phosphatase; Suppressor of actin mutations 1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAATTYERLKLHVTPEKFYVEACDDGADDVLIIDRVSTEVTLSVKKDIPPSAVTRPIFGI LGTIHLVAGNYLIVITKKKKIGEFFNHVIWKATDFDVLSYKKTMLHLTDIQLQDNKTFLA MMNHVLSMDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET EQIVHYNGSRASFVQTRGSIPLYWSQRPNLKYKPLPLINKVANHMDGFQRHFDSQIIIYG KQVIINLVNQKGSEKPLEQAFATMVSSLGNGMIRYIAFDFHKECKNMRWDRLSILLDQVA EMQDELSYFLVDPAGVVLSTQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQLGLIMDGWNSLIR YYKNNFSDGFRQDSIDLFLGNYSVDELESHSPLSVPRDLKFLALPIIMVVAFSMCIICLL MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID
Uniprot No.

Target Background

Function
Phosphatidylinositide phosphatase catalyzing the hydrolysis of phosphatidylinositol 4-phosphate (PtdIns(4)P) and phosphatidylinositol 3-phosphate (PtdIns(3)P). It exhibits low activity towards phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Robust PtdIns(4)P phosphatase activity is observed when binding PtdIns(4)P in a 'cis' configuration within the cellular environment, with significantly reduced activity in a 'trans' configuration. PtdIns(4)P phosphatase activity (in the 'trans' configuration) is enhanced by PLEKHA3.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is SAC1/SACM1L and what are its primary functions?

SAC1 (Suppressor of Actin mutations 1), also known as SACM1L, is an integral membrane phosphoinositide phosphatase that plays crucial roles in lipid metabolism. This enzyme functions primarily to hydrolyze phosphatidylinositol 4-phosphate (PtdIns4P), converting it to phosphatidylinositol (PtdIns) . It also acts on phosphatidylinositol 3-phosphate and phosphatidylinositol 3,5-bisphosphate with moderate activity .

The protein is highly conserved across species and is essential for cellular viability, as evidenced by preimplantation lethality observed in knockout mice . Beyond its enzymatic activity, SAC1 has been implicated in:

  • Maintenance of phosphoinositide gradients between organelles

  • Organization of Golgi membranes

  • Regulation of mitotic spindle formation

  • Facilitation of non-vesicular lipid transport

Where is SAC1 localized in mammalian cells?

SAC1 is predominantly localized throughout the endoplasmic reticulum (ER) membrane network in mammalian cells. Using gene editing technologies such as the "split GFP" approach in HEK-293A cells, researchers have confirmed this extensive ER distribution . Unlike many proteins that function at membrane contact sites (MCS), SAC1 does not significantly enrich at these junctions .

While SAC1 primarily resides in the ER, it can also be detected in the Golgi apparatus. The enzyme's distribution appears to be diffuse throughout the ER rather than concentrated at specific subdomains, which has important implications for understanding its mode of action .

What is the domain organization of SAC1?

SAC1 is a type II transmembrane protein with a modular domain organization:

DomainApproximate PositionFunction
N-terminal catalytic domainResidues 1-450Contains the phosphatase active site
Linker regionResidues 451-520Essential for substrate recognition and catalysis
C-terminal TMDsResidues 521-587ER/Golgi membrane anchoring

The catalytic domain resides in the cytoplasm, while the transmembrane domains (TMDs) anchor the protein in the ER or Golgi membranes. The ~70 amino acid linker region between these domains has been shown to be essential for substrate recognition and catalysis . Studies have demonstrated that truncations removing residues 452-587 (including the linker region and TMD) abolish substrate recognition even when the catalytic domain is recruited to membranes .

What is the "cis" versus "trans" debate regarding SAC1 function?

The "cis" versus "trans" debate centers around how SAC1, an ER-resident enzyme, accesses its phosphoinositide substrates that are primarily located in other cellular membranes:

"Cis" model: SAC1 degrades phosphoinositides in its resident membrane (ER). This model requires phosphoinositides to be transported from other organelles to the ER for SAC1 to act on them.

"Trans" model: SAC1 reaches across membrane gaps at contact sites to dephosphorylate phosphoinositides in opposing membranes without requiring lipid transport.

Research evidence strongly supports the "cis" model as the predominant mechanism :

  • When SAC1 activity is inhibited with hydrogen peroxide, PtdIns4P accumulates in the ER rather than in other membranes, consistent with the "cis" model .

  • SAC1 does not specifically enrich at membrane contact sites, where "trans" activity would be expected to occur .

  • When artificially tethered to membrane contact sites, SAC1 shows poor "trans" activity unless its linker region is extended by ~6 nm, suggesting the native enzyme cannot effectively reach across the typical 15-25 nm gap at contact sites .

This debate has significant implications for understanding phosphoinositide metabolism and non-vesicular lipid transport mechanisms.

How do researchers experimentally distinguish between "cis" and "trans" activity?

Researchers employ several complementary approaches to distinguish between "cis" and "trans" activity of SAC1:

  • Acute inhibition assays:

    • Treating cells with SAC1 inhibitors (e.g., hydrogen peroxide)

    • Monitoring PtdIns4P accumulation using specific biosensors

    • In experiments, PtdIns4P accumulation in the ER (rather than PM) supports the "cis" model

  • Localization analysis:

    • Visualizing SAC1 distribution relative to membrane contact site markers

    • Studies show SAC1 distributes throughout the ER without specific enrichment at contact sites

  • Engineered SAC1 variants with extended linkers:

    • Creating SAC1 chimeras with helical linker sequences (EAAAR repeats)

    • Each repeat adds approximately 7.5 Å when forming an α-helix

    • Only variants with sufficiently long linkers (~6 nm extension) show "trans" activity

  • Chemically-induced dimerization:

    • Using FKBP-FRB system to target SAC1 to specific membrane compartments

    • Comparing activity of full-length SAC1-FRB versus truncated SAC1ΔTMD-FKBP

    • Native SAC1 shows robust "cis" activity but poor "trans" activity without artificial extension

These approaches collectively provide strong evidence that SAC1 predominantly functions in the "cis" configuration in cellular contexts.

What methodologies are used to measure SAC1 phosphatase activity in vitro?

Several key methodologies are employed to measure SAC1 phosphatase activity in controlled in vitro settings:

  • Reconstitution systems:

    • Using purified recombinant SAC1 catalytic domain

    • Lipid vesicles containing defined phosphoinositide substrates

    • Activity measured by detecting phosphate release or substrate depletion

  • Fluorescent biosensors:

    • GFP-P4M domain: Detects PtdIns4P with high specificity

    • GFP-P4M×2 (tandem domain): Higher avidity for detecting low levels of PtdIns4P

    • These biosensors allow real-time tracking of substrate depletion

  • Chemically-induced dimerization:

    • SAC1ΔTMD-FKBP can be recruited to FRB-containing membranes

    • Activity detected using biosensors like GFP-P4M×2

    • Allows testing of different SAC1 variants in controlled settings

  • Malachite green assay:

    • Colorimetric assay quantifying free phosphate released during phosphatase activity

    • Enables kinetic measurements of SAC1 activity against different substrates

These approaches can be combined with site-directed mutagenesis to assess the importance of specific residues for catalytic activity or substrate recognition.

How does SAC1 contribute to phosphoinositide gradient maintenance?

SAC1 plays a central role in phosphoinositide metabolism by maintaining phosphoinositide concentration gradients between organelles, particularly for PtdIns4P:

  • Gradient establishment: By continuously degrading PtdIns4P in the ER, SAC1 creates and maintains a concentration gradient of this lipid between the ER (low) and other organelles like the plasma membrane (high) .

  • Thermodynamic driver: This PtdIns4P gradient provides the energy for OSBP-related proteins (ORPs) to transport other lipids against their concentration gradients, functioning analogously to a "water wheel" system .

  • Phosphoinositide metabolic flux: SAC1 is crucial for driving this flux, where PtdIns4P is synthesized in organelles by PI4-kinases, transported to the ER by ORPs, and degraded by SAC1 to complete the cycle .

This system creates a directional flow of phosphoinositides that is essential for membrane identity and cellular function. SAC1's "cis" mode of activity is critical for this function, as it spatially segregates PtdIns4P metabolism and allows for the establishment of the gradient .

What is the role of SAC1 in non-vesicular lipid transport?

SAC1 provides the thermodynamic driving force for non-vesicular lipid transport systems:

  • Phosphoinositide degradation engine: By continuously degrading PtdIns4P in the ER, SAC1 maintains a steep concentration gradient that drives directional transport of this lipid from other membranes to the ER .

  • Counter-transport facilitation: The energy released from PtdIns4P moving down its concentration gradient powers the counter-transport of other lipids against their concentration gradients, such as:

    • Cholesterol movement from ER to plasma membrane

    • Phosphatidylserine transport from ER to plasma membrane

This mechanism is visualized as a "water wheel" system :

  • PtdIns4P is synthesized in the plasma membrane by PI4-kinases

  • OSBP-related proteins transfer PtdIns4P from PM to ER

  • SAC1 degrades PtdIns4P in the ER, maintaining the gradient

  • Each cycle of PtdIns4P transport is coupled to counter-transport of another lipid

The "cis"-acting nature of SAC1 is fundamental to this process, as it ensures that PtdIns4P is only degraded after being delivered to the ER, maintaining the directionality of transport .

How do membrane contact sites influence SAC1 function?

While SAC1 itself does not preferentially localize to membrane contact sites (MCS), these structures significantly impact SAC1 function in phosphoinositide metabolism:

  • Substrate delivery platform: MCS between the ER and other organelles serve as platforms for OSBP-related proteins to transfer PtdIns4P from target membranes to the ER, where SAC1 can degrade it in "cis" mode .

  • Spatial organization: The close apposition of membranes at MCS (typically 15-25 nm) facilitates efficient lipid transfer, though this distance is too great for native SAC1 to bridge directly .

  • Functional coupling: SAC1's activity is functionally coupled to lipid transfer proteins that operate at MCS, even though SAC1 itself is distributed throughout the ER .

Experimental evidence shows that SAC1 does not show significant enrichment at ER-PM contact sites, nor does it exhibit robust "trans" activity across these junctions without artificial extension of its linker region . This indicates that rather than reaching across MCS, SAC1 relies on lipid transfer proteins to bring substrates to its location in the ER.

What controls should be included when studying recombinant bovine SAC1?

When working with recombinant bovine SAC1, several essential controls should be included:

  • Enzyme controls:

    • Catalytically inactive mutant (e.g., C/S mutation in active site)

    • Truncation variants lacking essential regions (e.g., ΔTMD, Δlinker region)

    • Wild-type enzyme with specific inhibitors (e.g., hydrogen peroxide)

  • Substrate specificity controls:

    • Multiple phosphoinositide species to confirm specificity

    • Non-phosphoinositide lipids as negative controls

    • Varying substrate concentrations to determine kinetic parameters

  • Expression and purification controls:

    • Western blotting to confirm protein integrity

    • Size exclusion chromatography to verify proper folding

    • Activity assays with established substrates to confirm functionality

  • Cellular localization controls:

    • Co-localization with established ER markers

    • Comparison with other phosphoinositide phosphatases

    • Verification that recombinant protein localizes similarly to endogenous protein

These controls ensure that experimental observations genuinely reflect SAC1's intrinsic properties rather than artifacts of the experimental system.

What are the challenges in producing functional recombinant bovine SAC1?

Producing functional recombinant bovine SAC1 presents several challenges:

  • Membrane protein expression:

    • Full-length SAC1 contains transmembrane domains, making expression and purification difficult

    • Expression systems must be carefully chosen (mammalian, insect, or bacterial)

    • Detergent selection is critical for maintaining protein stability and activity

  • Maintaining structural integrity:

    • The ~70 amino acid linker region between the catalytic domain and TMD is essential for function

    • Truncated versions lacking this region show impaired substrate recognition

    • Proper folding of the catalytic domain must be verified

  • Activity preservation:

    • Phosphatase activity can be sensitive to buffer conditions, pH, and salt concentration

    • Presence of reducing agents may be necessary to maintain active site cysteines

    • Storage conditions must prevent aggregation and denaturation

  • Species-specific considerations:

    • While bovine SAC1 shares high homology with human and other mammalian orthologs, species-specific differences in post-translational modifications may exist

    • Expression in homologous systems may be preferred for certain applications

Researchers often use truncated versions (catalytic domain only) for in vitro studies, while employing full-length protein for cellular localization and in vivo functional studies .

How can contradictory results in SAC1 research be reconciled?

Reconciling contradictory results in SAC1 research requires careful consideration of multiple factors:

  • Experimental system differences:

    • In vitro vs. cellular systems: In vitro reconstitutions may permit activities that are constrained in cellular environments

    • Purified domains vs. full-length protein: Truncated proteins may exhibit altered activities

    • Overexpression artifacts: Non-physiological protein levels can force non-native interactions

  • Model system variation:

    • Yeast vs. mammalian systems: SAC1 functions may have evolved differently across species

    • Different cell lines may have distinct phosphoinositide metabolism patterns

  • Assay sensitivity and specificity:

    • Direct vs. indirect activity measurements: Different assays may have varying sensitivity

    • Temporal resolution: Acute vs. chronic manipulations can yield different outcomes

    • Spatial resolution: Subcellular localization information can be lost in whole-cell assays

For example, contradictions between in vitro evidence for "trans" activity and cellular evidence for "cis" activity can be reconciled by considering:

  • In vitro systems may lack constraints present in cells (e.g., protein crowding)

  • Artificial membrane spacing in reconstitutions may not reflect native MCS dimensions

  • The energetics of lipid extraction may differ between simplified and cellular membranes

An integrated approach using complementary methodologies is most likely to resolve apparent contradictions in SAC1 research.

What are the latest methodologies for visualizing SAC1 activity in live cells?

Cutting-edge methodologies for visualizing SAC1 activity in live cells include:

  • Genetically-encoded phosphoinositide biosensors:

    • GFP-P4M domain: Detects PtdIns4P with high specificity

    • GFP-P4M×2 (tandem domain): Higher avidity for detecting low levels of PtdIns4P

    • These biosensors allow real-time tracking of PtdIns4P dynamics

  • Endogenous protein tagging:

    • Split GFP approach: GFP11 tag introduced to endogenous SAC1 in cells expressing GFP1-10

    • CRISPR-Cas9 knock-in of fluorescent tags

    • These approaches visualize endogenous SAC1 without overexpression artifacts

  • Acute manipulation systems:

    • Chemical dimerization using FKBP/FRB domains to rapidly recruit SAC1

    • Optogenetic recruitment systems for light-controlled localization

    • These allow temporal control over SAC1 localization and activity

  • Super-resolution microscopy:

    • Techniques such as PALM, STORM, or STED can resolve SAC1 localization relative to membrane contact sites at nanometer resolution

    • These approaches have revealed that SAC1 does not specifically enrich at membrane contact sites

These methodologies can be combined with acute inhibition strategies to observe the immediate consequences of SAC1 inactivation, providing insights into the enzyme's mode of action.

How can researchers effectively study SAC1 interactions with other proteins?

Several approaches are effective for studying SAC1 interactions with partner proteins:

  • Proximity labeling methods:

    • BioID or APEX2 fused to SAC1 to identify proximal proteins

    • TurboID for faster labeling kinetics

    • These methods can identify proteins that transiently interact with SAC1

  • Co-immunoprecipitation with crosslinking:

    • Chemical crosslinkers can capture transient interactions

    • Mass spectrometry analysis of co-immunoprecipitated proteins

    • Comparison between wild-type and catalytically inactive mutants

  • Fluorescence resonance energy transfer (FRET):

    • Fluorescently tagged SAC1 and potential interacting partners

    • Live-cell FRET measurements to detect interactions in real-time

    • Can reveal spatial and temporal dynamics of interactions

  • Split protein complementation:

    • Similar to the split GFP approach used for visualization

    • Can be adapted using luciferase or other enzymes as reporters

    • Allows for quantitative assessment of protein-protein interactions

  • In vitro binding assays:

    • Surface plasmon resonance (SPR) with purified proteins

    • Pull-down assays with recombinant proteins

    • Isothermal titration calorimetry (ITC) for binding affinity measurements

These approaches can be particularly useful for understanding how SAC1 coordinates with OSBP-related proteins in lipid transport and metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.