Recombinant Bovine Platelet-activating factor receptor (PTAFR)

Shipped with Ice Packs
In Stock

Description

Biological Significance

The Platelet-Activating Factor Receptor (PTAFR), also known as PAFR or PAFr, belongs to the rhodopsin gene family and serves as the binding site for platelet-activating factor (PAF), a potent phospholipid mediator implicated in diverse pathological processes . In cattle specifically, PTAFR has been associated with reproduction processes and plays a significant role in inflammatory-like processes within the uterus that are associated with increased vascular permeability . The receptor is part of a complex signaling network that mediates innate immunity responses and inflammatory cascades, making it a crucial component in bovine physiology and pathophysiology.

Genomic Characterization

Through advanced genomic techniques, the PTAFR gene has been definitively mapped to Bos taurus (BTA) chromosome 2 at approximately 129.4 megabases, as confirmed by both fluorescence in situ hybridization (FISH) and somatic hybrid cell (SHC) mapping methods . This chromosomal assignment provides essential information for understanding the genetic regulation of PTAFR expression and its relationship to other genes involved in immunity and inflammation. The confirmation of this annotation through independent physical mapping methods has strengthened our understanding of the genomic architecture surrounding this important receptor.

Recombinant Technology Applications

The production of recombinant bovine PTAFR has enabled researchers to study the receptor's properties without the complexities associated with native tissue extraction. Recombinant technology allows for controlled expression, specific modifications such as affinity tags, and production of quantities sufficient for structural and functional analyses. This approach has proven invaluable for exploring receptor-ligand interactions, signaling pathways, and potential therapeutic interventions targeting PTAFR-mediated processes in bovine health and disease.

Expression Systems

Recombinant bovine PTAFR is primarily produced using Escherichia coli expression systems, which offer advantages in terms of scalability, cost-effectiveness, and yield . The bacterial expression approach, similar to that used for other bovine proteins like prethrombin-2, typically employs T7 expression systems for efficient protein production . When expressed in E. coli, the protein often forms inclusion bodies that require specialized solubilization and refolding processes to recover functional protein . While mammalian expression systems could potentially provide more native-like post-translational modifications, the E. coli system has proven efficient for basic structural and functional studies of bovine PTAFR.

Purification and Refolding Strategies

The purification of recombinant bovine PTAFR from E. coli typically involves several steps designed to isolate the protein and restore its native conformation. Drawing parallels from similar recombinant bovine protein purification procedures, this often includes:

  1. Solubilization of inclusion bodies using denaturants such as guanidine hydrochloride

  2. Protein refolding using controlled dilution or dialysis with redox couples (like oxidized and reduced glutathione)

  3. Affinity chromatography leveraging the His-tag for selective purification

  4. Quality control assessment through SDS-PAGE and functional assays

These procedures are essential for obtaining functional recombinant PTAFR that accurately represents the native receptor's properties. The refolding step is particularly critical as it determines whether the receptor will adopt its correct three-dimensional structure necessary for ligand binding and signaling.

Ligand Binding Characteristics

Bovine PTAFR specifically binds platelet-activating factor (PAF), a potent phospholipid mediator involved in various physiological and pathological processes . The receptor exhibits high affinity for its natural ligand alkyl-PAF, though it can also interact with related molecules such as acyl-PAF with different binding affinities . These differential binding characteristics allow for nuanced regulation of receptor activation, with some ligands acting as full agonists and others as partial agonists or even antagonists. Studies using recombinant bovine PTAFR have provided valuable insights into the specific structural requirements for ligand recognition and receptor activation.

Signal Transduction Pathways

Upon activation by PAF, bovine PTAFR initiates complex signaling cascades that ultimately lead to inflammatory responses. Research has demonstrated that PAF signaling through PTAFR involves multiple pathways including:

  1. Activation of IκB kinase pathways

  2. Calcium/calmodulin-dependent protein kinase II signaling

  3. Induction of inflammatory mediators such as inducible nitric oxide synthase (Nos2)

  4. Production of chemokines like Ccl5 (RANTES) and cytokines including tumor necrosis factor (TNF)

Interestingly, these signaling pathways appear to be interconnected with Toll-like receptor (TLR) signaling, particularly TLR4, as PAF-induced inflammatory responses are severely impaired in cells lacking TLR4, MyD88, or TRIF . This cross-talk between PTAFR and TLR signaling highlights the complex integration of different innate immunity pathways in bovine inflammatory responses.

Role in Reproduction and Inflammation

In cattle, PTAFR plays crucial roles in reproductive physiology and inflammation, particularly in uterine tissues . The receptor mediates inflammatory-like processes within the uterus that are associated with increased vascular permeability, which may be important for successful implantation and maintenance of pregnancy . Additionally, PAF-PTAFR signaling has been implicated in preterm delivery models, suggesting its importance in regulating the timing of parturition . The balance between pro-inflammatory and anti-inflammatory signals mediated by PTAFR appears to be critical for normal reproductive function in bovines.

Structure-Function Studies

Recombinant bovine PTAFR provides an excellent tool for structure-function studies aimed at understanding the molecular basis of receptor activation and signaling. By introducing specific mutations into the recombinant protein, researchers can identify critical residues involved in ligand binding, G-protein coupling, and downstream signaling . Such studies have parallels with work on other bovine proteins like prethrombin-2, where recombinant expression systems enabled detailed analysis of structure-function relationships . These approaches are essential for developing a comprehensive understanding of how PTAFR contributes to physiological and pathological processes in cattle.

Inflammatory Disease Models

The involvement of PTAFR in inflammatory processes makes it a valuable target for studying inflammatory diseases in cattle. Experimental models using recombinant PTAFR or cells/animals with modified PTAFR expression have helped elucidate the receptor's role in various inflammatory conditions . Studies have shown that PAF-AH knockout mice, which have impaired PAF degradation, exhibit increased susceptibility to E. coli-induced preterm delivery and inflammation, highlighting the importance of PAF-PTAFR signaling in inflammatory responses . These models provide insights into potential therapeutic strategies targeting PTAFR in bovine inflammatory diseases.

Reproductive Biology Research

The association of PTAFR with reproductive processes in cattle makes recombinant PTAFR particularly valuable for studies in bovine reproductive biology . Research has focused on understanding how PTAFR signaling contributes to uterine vascular permeability changes during the estrous cycle and early pregnancy . Additionally, the cross-talk between PTAFR and other signaling pathways, such as TLR signaling, in reproductive tissues provides insights into the complex regulation of reproductive processes in cattle . These studies have important implications for managing reproductive efficiency in cattle and developing strategies to address reproductive disorders.

Therapeutic Potential

The involvement of PTAFR in inflammation and reproduction suggests potential therapeutic applications targeting this receptor in cattle. Recombinant bovine PTAFR can serve as a valuable tool for screening potential antagonists or modulators that might be developed into treatments for inflammatory conditions or reproductive disorders . The complex interplay between PAF, its receptor, and PAF acetylhydrolase (PAF-AH) offers multiple points for therapeutic intervention . Future research may focus on developing specific PTAFR modulators tailored to bovine physiology for veterinary applications.

Technical Challenges and Solutions

Despite the valuable insights gained from recombinant bovine PTAFR, several technical challenges remain in its production and study. The expression of functional G-protein coupled receptors like PTAFR in bacterial systems often results in inclusion bodies requiring complex refolding procedures . Alternative expression systems, such as insect cells or mammalian cells, might provide more natively folded protein but at higher production costs. Additionally, maintaining the stability of the purified receptor for structural studies presents ongoing challenges that researchers continue to address through improved buffer formulations and storage protocols .

Emerging Research Directions

Recent advances in our understanding of PTAFR biology suggest several promising directions for future research. The discovered cross-talk between PTAFR and TLR signaling pathways opens new avenues for investigating innate immunity integration in cattle . Additionally, the differential effects of various PAF species (such as alkyl-PAF and acyl-PAF) on PTAFR activation suggest complex regulatory mechanisms that warrant further investigation . Modern techniques such as CRISPR/Cas9 gene editing could enable more precise studies of PTAFR function in bovine cells and potentially in cattle themselves, offering unprecedented insights into this receptor's physiological roles.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it for your product.
Synonyms
PTAFR; PAFR; Platelet-activating factor receptor; PAF-R; PAFr
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MEPNNSFRVDSEFRYTLFPIFYSIVFVLGVIANSYVLWVFARLYPSKKFNEIKIFMVNLT MADLLFLVTLPLWIVYYYNQGDWILPKFLCNLAGCFFFINTYCSVAFLAVITYNRFQAVT RPIKTAQATTRKRGILLSLIIWVSIVGAASYFFVLDSTNREPNKTGSANITRCFEHYEKG SIPVLTIHIFLVFSFFLVFLIILFCNLVIIRTLLTQQVQIQRNAEVKRRALWMVCTVLAV FIICFVPHHLVQLPWTLAELGFQDTDFHQAINDAHQVTLCLLSTNCVLDPIIYCFLTKKF RKHLTEKLYSMRESRKCSRATSETGTEVVMQLKDVPVKSLKY
Uniprot No.

Target Background

Function
The Platelet-activating factor receptor (PTAFR) is a receptor for platelet activating factor (PAF), a potent chemotactic phospholipid mediator that plays a crucial role in inflammatory responses, smooth muscle contraction, and hypotension. It exerts its effects through a G protein-mediated pathway, activating a phosphatidylinositol-calcium second messenger system. PTAFR is believed to be involved in the morphological and physical alterations of the oviduct and uterus during the estrous cycle and early pregnancy.
Gene References Into Functions
  1. PAF and luteinizing hormone signaling play a critical role in regulating the production of excessive oxidants. PMID: 19565634
  2. Research indicates that PAFr is expressed in bovine granulosa cells and plays a functional role in PAF/PAFr-mediated cell recruitment. PMID: 18021181
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Found in oviductal epithelial and stroma cells. Levels in the oviduct are raised at days 2-4 of both pregnancy and of the estrus cycle. In the endometrium, localization is predominantly to the apical borders of glandular and luminal epithelial cells. Expr

Q&A

What expression systems are used for producing recombinant bovine PTAFR?

The most common expression system for producing recombinant bovine PTAFR is Escherichia coli (E. coli). This bacterial expression system is preferred for its high yield, cost-effectiveness, and established protocols. The protein is typically expressed with an N-terminal His-tag to facilitate purification using affinity chromatography techniques. For functional studies requiring post-translational modifications, mammalian expression systems may be more appropriate, though this approach is less common for basic structural studies .

When designing experiments, researchers should consider the limitations of bacterial expression systems, particularly the absence of post-translational modifications that might be present in the native bovine protein. For studies focused on receptor signaling or ligand binding, additional validation with naturally expressed PTAFR is recommended.

What are the optimal storage conditions for recombinant bovine PTAFR preparations?

Recombinant bovine PTAFR should be stored at -20°C or preferably -80°C upon receipt. To maintain protein stability, aliquoting is necessary to avoid repeated freeze-thaw cycles, which can lead to protein degradation. For working stocks, short-term storage at 4°C for up to one week is acceptable. The lyophilized form of the protein offers greater stability during storage than reconstituted solutions .

For long-term storage, it is recommended to add glycerol (final concentration of 5-50%, with 50% being optimal) to the reconstituted protein solution before aliquoting. This practice helps prevent protein degradation during the freezing process. Researchers should document the date of reconstitution and number of freeze-thaw cycles for each aliquot to ensure experimental reproducibility.

What is the recommended protocol for reconstituting lyophilized recombinant bovine PTAFR?

For optimal reconstitution of lyophilized recombinant bovine PTAFR:

  • Briefly centrifuge the vial before opening to ensure the powder is at the bottom of the tube

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) for storage stability

  • Prepare small aliquots to avoid repeated freeze-thaw cycles

  • Store aliquots at -20°C or -80°C for long-term use

It's important to note that the buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) should be considered when designing experiments to avoid potential buffer incompatibilities with downstream applications.

How can researchers validate the activity and specificity of recombinant bovine PTAFR?

Validating recombinant bovine PTAFR activity requires multiple complementary approaches:

  • SDS-PAGE analysis: Confirm protein purity (>90% as the standard threshold) and expected molecular weight

  • Western blotting: Verify specificity using anti-PTAFR and anti-His antibodies

  • Binding assays: Test functional activity through ligand binding studies with platelet-activating factor (PAF)

  • Cell-based assays: Evaluate receptor activation in transfected cells by measuring calcium mobilization or downstream signaling pathways

  • Competitive binding assays: Use known PTAFR antagonists to confirm binding specificity

For quantification in tissue samples, researchers should employ RT-qPCR (as demonstrated in AD mouse models) with appropriate housekeeping genes for normalization. Protein levels can be assessed via immunofluorescence staining, as performed in hippocampal tissues from APP/PS1 mice .

What experimental models are most appropriate for studying PTAFR's role in neuroinflammation?

Based on current research, several experimental models have proven effective for studying PTAFR in neuroinflammation:

  • APP/PS1 double transgenic mice: This AD mouse model has demonstrated significant upregulation of PTAFR expression at both mRNA and protein levels in hippocampal tissue. These mice show age-dependent development of Aβ plaques and cognitive deficits, making them suitable for longitudinal studies of PTAFR's role in disease progression .

  • LPS+Aβ-induced BV2 microglial cells: This in vitro model simulates neuroinflammatory conditions relevant to AD. BV2 cells treated with lipopolysaccharide (LPS) and amyloid beta (Aβ) show significant upregulation of PTAFR, making this a useful model for mechanistic studies and drug screening .

  • Primary microglial cultures: For more physiologically relevant studies, primary microglia isolated from bovine brain tissue can be stimulated with inflammatory mediators to study PTAFR expression and signaling.

When designing experiments, researchers should carefully consider the timepoint of analysis, as PTAFR expression changes with disease progression. In APP/PS1 mice, 12-month-old animals show significantly elevated expression compared to age-matched controls .

How does PTAFR function in the microglia-mediated neuroinflammatory response?

PTAFR has been identified as a critical mediator in the microglia-mediated neuroinflammatory response. Research indicates that PTAFR exaggerates microglia-mediated neuroinflammation through the IL10-STAT3 signaling pathway. The mechanism involves:

  • Increased PTAFR expression in activated microglia

  • Enhanced production of inflammatory cytokines and chemokines

  • Altered microglial phenotype toward a pro-inflammatory state

  • Exacerbation of neuronal damage through microglial-mediated neurotoxicity

This pathway has been demonstrated in both in vivo (APP/PS1 mice) and in vitro (LPS+Aβ-induced BV2 cells) models. The upregulation of PTAFR correlates with AD progression markers, including MMSE scores, Braak staging, and neurofibrillary tangle scores, suggesting its potential utility as a biomarker for disease progression .

For researchers investigating this pathway, inhibition studies using PTAFR antagonists or siRNA-mediated silencing would provide valuable insights into the causal relationship between PTAFR activation and neuroinflammatory outcomes.

What molecular docking approaches are suitable for studying PTAFR interactions with potential therapeutic compounds?

For studying PTAFR interactions with potential therapeutic compounds, the Molecular Operating Environment (MOE) software has been successfully employed. The approach should include:

  • Protein structure preparation: Using crystallographic data or homology models of PTAFR

  • Ligand preparation: Optimizing 3D structures of candidate compounds

  • Binding site identification: Defining the binding pocket based on known interactions

  • Docking simulation: Evaluating binding poses and interaction energies

  • Scoring: Using S-values (where S < -7 indicates significant binding probability)

Previous docking studies have identified potential interactions between PTAFR and several compounds including EGCG (S = -7.7826), curcumin (S = -7.5698), and donepezil (S = -7.5199). Compounds with planar structures and multiple benzene rings showed higher binding probabilities compared to those with stereo conformations .

For researchers pursuing this approach, it's important to validate computational findings with experimental binding assays and functional studies to confirm the physiological relevance of the predicted interactions.

What evidence supports PTAFR as a potential biomarker for neurodegenerative diseases?

Several lines of evidence support PTAFR's potential as a biomarker for neurodegenerative diseases, particularly Alzheimer's Disease:

  • Gene expression analysis: Screening of GEO database cohorts (GSE1297, GSE63063, GSE110226) identified PTAFR as significantly correlated with AD severity markers including MMSE score, Braak staging, and neurofibrillary tangle scores .

  • Animal model validation: 12-month-old APP/PS1 transgenic mice showed significantly upregulated PTAFR expression in both hippocampal tissue and peripheral blood compared to age-matched controls .

  • Correlation with pathology: PTAFR expression correlates with inflammatory processes that precede Aβ plaque formation, potentially allowing for earlier detection than current biomarkers .

  • Accessibility in peripheral samples: Importantly, PTAFR elevation was detectable in peripheral blood, making it potentially valuable as a non-invasive biomarker, unlike CSF-based markers that require lumbar puncture .

For researchers exploring PTAFR as a biomarker, longitudinal studies correlating PTAFR levels with disease progression would be valuable to establish its predictive validity. Additionally, comparisons with established biomarkers (Aβ42, T-tau, p-tau) would help position PTAFR within the existing diagnostic framework.

What methodologies are most effective for quantifying PTAFR expression in clinical samples?

For quantifying PTAFR expression in clinical samples, several complementary methodologies have proven effective:

  • RT-qPCR: For mRNA quantification in both tissue and peripheral blood samples. This method should include appropriate reference genes for normalization and follow MIQE guidelines for reproducibility .

  • Western blotting: For protein-level quantification in tissue samples, providing information on protein expression levels and potential post-translational modifications .

  • Immunofluorescence staining: For spatial localization of PTAFR in tissue sections, allowing assessment of cell-type specific expression patterns .

  • Flow cytometry: For quantifying PTAFR expression on specific cell populations in peripheral blood samples.

  • ELISA: For detecting soluble PTAFR or PTAFR fragments in plasma, serum, or cerebrospinal fluid.

When implementing these methods, researchers should establish standardized protocols that include appropriate positive and negative controls, detailed sample handling procedures, and consistent analysis parameters to ensure reproducibility across different laboratories and patient cohorts.

How is PTAFR expression in platelets associated with thrombotic risk in inflammatory conditions?

Recent research has identified a potential connection between PTAFR expression in platelets and thrombotic risk in inflammatory conditions, particularly in COVID-19. Key findings include:

  • Significant hyperexpression of PTAFR and PF4 genes in unvaccinated and hospitalized COVID-19 patients compared to healthy controls .

  • This hyperexpression correlates with disease severity and clinical variables including hospitalization outcomes .

  • The association suggests PTAFR may contribute to the prothrombotic state observed in severe COVID-19, characterized by elevated coagulation markers and increased platelet activation and aggregation .

For researchers investigating this relationship, it would be valuable to design studies that:

  • Compare PTAFR expression levels with established markers of platelet activation and aggregation

  • Examine the correlation between PTAFR expression and clinical thrombotic events

  • Investigate whether PTAFR antagonists could modulate platelet activation in inflammatory conditions

Methodologically, flow cytometry analysis of platelets with PTAFR-specific antibodies combined with activation markers would provide insights into the relationship between PTAFR expression and platelet reactivity.

What experimental approaches can distinguish between PTAFR-mediated effects and other inflammatory pathways in platelets?

To distinguish PTAFR-mediated effects from other inflammatory pathways in platelets, researchers should consider these experimental approaches:

  • Specific PTAFR antagonists: Using compounds like CV-3988, WEB-2086, or rupatadine in parallel with pathway-specific inhibitors for non-PTAFR inflammatory mediators

  • Genetic approaches: CRISPR-Cas9 editing or siRNA knockdown of PTAFR in platelet precursor cells or appropriate cell lines

  • Receptor occupancy assays: Using labeled PAF to determine receptor occupancy and competition with potential antagonists

  • Downstream signaling analysis: Measuring calcium mobilization, phospholipase C activation, and protein kinase C phosphorylation as PTAFR-specific readouts

  • Combined inhibition studies: Systematic inhibition of multiple pathways to identify synergistic or independent effects

When designing these experiments, appropriate controls are essential, including isotype-matched antibodies for flow cytometry, vehicle controls for pharmacological agents, and scrambled siRNA sequences for genetic approaches.

How can researchers leverage cross-species comparisons of PTAFR to enhance translational research?

Cross-species comparisons of PTAFR offer valuable opportunities for translational research:

  • Sequence homology analysis: Compare bovine PTAFR with human, murine, and other mammalian species to identify conserved domains crucial for function and species-specific variations that might affect drug interactions.

  • Function conservation studies: Evaluate whether bovine PTAFR responses to ligands and inhibitors parallel those of human PTAFR, particularly in inflammatory cascades relevant to disease models.

  • Cross-species validation platforms: Develop systems where findings in bovine models can be rapidly validated in human cell lines or samples to accelerate translational discoveries.

  • Evolutionary context analysis: Examine how PTAFR function has evolved across species to gain insights into its fundamental biological roles versus species-specific adaptations.

When implementing this approach, researchers should systematically compare PTAFR expression patterns, signaling pathways, and responses to pharmacological agents across species. This would facilitate more accurate extrapolation from animal models to human disease processes.

What role might PTAFR play at the intersection of neuroinflammation and cerebrovascular pathology?

The potential role of PTAFR at the intersection of neuroinflammation and cerebrovascular pathology represents an emerging research area:

  • PTAFR expression in both platelets and microglia suggests it may serve as a bridge between vascular and neural inflammatory processes .

  • In neurodegenerative conditions like AD, both microglial activation and vascular dysfunction contribute to pathology, with PTAFR potentially linking these processes.

  • The connection between PTAFR hyperexpression in COVID-19 patients and their thrombotic complications suggests similar mechanisms might be relevant in cerebrovascular aspects of neurodegeneration .

For researchers exploring this intersection, experimental approaches could include:

  • Co-culture systems using microglia and brain endothelial cells to study PTAFR-mediated cross-talk

  • Animal models that combine vascular and neurodegenerative features

  • Analysis of PTAFR expression in different cell types within the neurovascular unit

This research direction could yield insights into how systemic inflammatory conditions affect neurological function through PTAFR-mediated mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.