Recombinant Bovine polyomavirus Minor capsid protein VP2

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Polyomavirus Minor Capsid Protein VP2

Recombinant Bovine Polyomavirus Minor Capsid Protein VP2 is a protein expressed using recombinant DNA technology, derived from the VP2 protein of the bovine polyomavirus. In polyomaviruses, the viral capsid, which protects the genetic material, is composed of major and minor capsid proteins. VP2 is a minor capsid protein that plays a crucial role in the virus's life cycle, particularly in cell entry and virion assembly .

Role of VP2 in Polyomavirus Infections

VP2 is involved in the infectious entry process of polyomaviruses. Studies on Merkel Cell Polyomavirus (MCV) have shown that VP2 facilitates a post-attachment stage of viral entry into some, but not all, cell types . In MCV, VP2 is the only minor capsid protein, making its function critical for infectivity .

  • Infectious Entry: VP2 helps the virus enter host cells, although its necessity varies depending on the cell type .

  • Virion Assembly: VP2 interacts with the major capsid protein VP1 and histones, suggesting its involvement in transporting VP1 into the nucleus for virion assembly .

VP2 Structure and Function

The VP2 protein associates with the inner surface of the capsid. Key features of VP2 include:

  • Myristoylation: The N-terminal myristoyl modification of VP2 is important for its function in certain cell lines .

  • Nuclear Localization: VP2 does not exhibit strong nuclear localization unless co-expressed with VP1 .

  • Interaction with VP1: VP2 interacts with VP1 in the cytoplasm, aiding the transport of VP1 to the nucleus, which is essential for virion assembly .

Research Findings on VP2

Research on VP2, particularly in MCV, has revealed important insights into its function and role in viral infections.

FindingDescriptionReference
VP2 Facilitates Post-Attachment EntryVP2 aids in the entry of the virus into the host cell after the initial attachment.
VP2 Knockout Reduces InfectivityMutants lacking VP2 show a significant decrease in infectivity.
Cell-Type Specific Function of VP2VP2 is essential for efficient transduction in some cell types, while dispensable in others.
Interaction with VP1VP2 interacts with VP1, assisting in its transport to the nucleus for virion assembly.
No Nuclear Localization Signal (NLS) in VP2VP2 lacks a strong nuclear localization signal unless co-expressed with VP1, suggesting VP1 assists in VP2's nuclear transport.
VP2 MyristoylationThe myristoyl modification on the N-terminus of VP2 is important for its function in cell lines where VP2 is needed for efficient infectious entry.
VP2 and VP3 RelationshipMCV lacks the VP3 minor capsid protein; VP2 assumes critical functions typically shared with VP3 in other polyomaviruses. Studies suggest that VP1 may compensate for the absence of VP3.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Minor capsid protein VP2; Minor structural protein VP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-353
Protein Length
Full Length of Mature Protein
Species
Bovine polyomavirus (BPyV) (Bos taurus polyomavirus 1)
Target Protein Sequence
GALLTILAEVFELATATGLSAEAILTGEAFTTAELLQAHIANLVEVGELSVAEALAATEV TSEAFEALQSISSVLPTAFIGVAATEGAILGSLITLTATSSALYPSTWKHSTPSANLNQE MALVPYIGDLDIFFPGAETISRFVYSIDPFRWASYLYNIVGRAVWEHLFRETRRQIAYHT TDIAGRTAQSIHHTIANFLENVRWTVSHLGTNLYSGLHNYYRQLPPLNPPQSRELARRLG VPQPDRQIFEKGEEGMKHPVSAEYVEKYGAPGGAEQRVAPDWLLPLLLGLYGDLTPAWEA EVEEEENEQDEEEYEPPQKRIKRTAKSSSKVNNKRGDRSARSPYRTRQHNHN
Uniprot No.

Target Background

Function

Isoform VP2 is a structural protein located within the capsid core, surrounded by 72 VP1 pentamers. It participates in host cell receptor binding alongside VP1. Following virus endocytosis and transport to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. The VP2-VP3 hetero-oligomer may function as a viroporin, facilitating viral genome transport across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of the VP2 or VP3 nuclear localization signal (shared C-terminus). VP2 plays a role in virion assembly within the nucleus, particularly through a DNA-binding domain in its C-terminal region. N-terminal myristoylation suggests a scaffolding role in virion assembly. In summary, VP2 is a structural protein within the capsid core, involved in receptor binding, membrane integration, genome transport, and nuclear virion assembly. Isoform VP3 also contributes to virion assembly within the nucleus.

Database Links

KEGG: vg:29031003

Protein Families
Polyomaviruses capsid protein VP2 family
Subcellular Location
[Isoform VP2]: Virion. Host nucleus. Host endoplasmic reticulum. Host endoplasmic reticulum membrane.; [Isoform VP3]: Virion. Host nucleus. Host endoplasmic reticulum. Host endoplasmic reticulum membrane.

Q&A

What is the structural relationship between Bovine polyomavirus VP2 and the major capsid protein VP1?

Recombinant Bovine polyomavirus VP2 forms specific interactions with the pentameric major capsid protein VP1. Crystal structure analysis at 2.2 Å resolution reveals that a single copy of VP2 interacts with a VP1 pentamer through its C-terminal segment . This interaction is critical for viral assembly and function, as the VP2 protein inserts into the central cavity of the VP1 pentamer. The structure shows specific contacts that weren't fully detected in earlier virion structural studies, suggesting conformational adaptability in the assembled virus . Similar structural arrangements have been observed across different polyomaviruses, indicating a conserved mechanism of capsid assembly.

How do VP2 and VP3 proteins relate to each other in Bovine polyomavirus?

VP2 and VP3 share a common C-terminal region but differ in their N-terminal domains. VP3 is essentially a truncated version of VP2, lacking the N-terminal VP2-unique region . Both proteins interact with VP1 through their shared C-terminal segment. In experimental systems, polyclonal serum produced against recombinant VP2 cross-reacts with both polyomavirus virion VP2 and VP3 on Western blots, confirming their structural similarity and shared epitopes . This relationship has important implications for experimental design, as studies targeting the shared regions will affect both proteins.

What are the most conserved regions of polyomavirus VP2 across different viral species?

Sequence alignment of VP2 across eight polyomaviruses reveals several highly conserved stretches of amino acids, with the most notable conservation occurring in the C-terminal region that mediates interaction with VP1 . Particularly, a hydrophobic helix in VP2 is strongly conserved, suggesting its critical role in VP1 binding and viral assembly . Residues involved in VP1-VP2 interaction observed in vitro are required for productive viral infection, as demonstrated by mutagenesis studies in BK polyomavirus . These conserved regions represent potential targets for broad-spectrum antiviral strategies against polyomaviruses.

What expression systems are effective for producing recombinant Bovine polyomavirus VP2?

Escherichia coli has been successfully used for recombinant expression of polyomavirus VP2. Specifically, E. coli strain RK1448 with the recombinant expression system pFPYV2 has yielded functional VP2 protein . For co-expression of VP1 and VP2 complexes, E. coli systems have also proven effective, allowing formation of stable complexes that mimic those found in virions . When designing expression constructs, researchers should consider:

  • Codon optimization for the expression host

  • Addition of purification tags (e.g., GST tags that can be removed by thrombin cleavage)

  • Co-expression with VP1 to enhance stability and solubility

  • Expression of truncated versions focusing on functional domains

The choice of expression system should be guided by the intended experimental applications, with mammalian expression systems potentially offering more native post-translational modifications.

What purification methods yield highest purity recombinant VP2 protein?

Recombinant VP2 can be purified to near homogeneity using a multi-step purification process. Effective protocols include:

  • Initial separation by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE)

  • Electroelution of the VP2 band from the gel

  • Extracti-Gel chromatography to remove detergents and concentrate the protein

For VP1-VP2 complexes, affinity chromatography using glutathione columns (when GST-tagged constructs are used) followed by size-exclusion chromatography has yielded homogeneous complexes . The relative staining of VP1:VP2 bands suggests one internal protein per pentamer, consistent with structural studies . Researchers should verify protein purity using multiple methods including SDS-PAGE, Western blotting, and mass spectrometry to ensure consistent experimental results.

How can I verify the functional integrity of purified recombinant VP2?

Verification of recombinant VP2 functionality can be assessed through multiple assays:

  • In vitro protein-protein interaction assays with VP1 and histones to confirm binding properties

  • Co-immunoprecipitation studies with recombinant VP1 to assess complex formation

  • In vivo nuclear translocation assays by co-transfection with truncated VP1 lacking nuclear localization signals to test VP2's ability to transport VP1 to the nucleus

  • Structural analysis through crystallography or cryo-EM to confirm proper folding and interaction capabilities

  • Immunological recognition using antibodies against native VP2 to confirm structural similarity with the virion protein

Functional recombinant VP2 should demonstrate similar biochemical and biophysical properties to the native viral protein, including appropriate subcellular localization when expressed in mammalian cells.

What techniques are most informative for studying VP2-VP1 interactions?

Several complementary techniques provide valuable insights into VP2-VP1 interactions:

  • X-ray crystallography: Determines high-resolution structures of VP2-VP1 complexes, revealing specific contact points. This approach has successfully resolved a 2.2 Å structure of the VP2 C-terminal segment complexed with a VP1 pentamer .

  • Co-immunoprecipitation: Confirms interaction between recombinant VP1 and VP2 or truncated VP2 variants, allowing assessment of binding domains .

  • Size-exclusion chromatography: Evaluates the homogeneity and stoichiometry of VP1-VP2 complexes .

  • In vivo co-localization studies: Demonstrates functional interactions, such as VP2's ability to translocate VP1 into the nucleus .

  • Mutagenesis studies: Identifies critical residues required for interaction, as demonstrated by experiments showing that specific mutations in VP2's D1 region abolish productive viral infection .

These approaches collectively provide structural, biochemical, and functional evidence for the nature and significance of VP2-VP1 interactions.

How do mutations in VP2 affect polyomavirus infectivity and assembly?

Mutagenesis studies reveal that VP2 is critical for polyomavirus infectivity. Specific findings include:

  • BK polyomavirus is completely intolerant of VP2 or VP3 deletion, resulting in no detectable infectious virus production .

  • Alanine-substitutions within the D1 region of VP2/3 abolish viral infectivity, despite not significantly impacting VP2/3 expression levels .

  • Mutations in VP1 residues that mediate binding to the VP2/3-derived peptide D1 (specifically P232 and V234) severely impair viral infectivity in spreading infection assays .

  • The carboxy-terminal 12 amino acids of VP2 and VP3 are not necessary for interaction with VP1, as demonstrated by co-immunoprecipitation studies with truncated VP2 (delta C12VP2) .

These findings indicate that while certain regions of VP2 are dispensable for VP1 binding, specific residues in the D1 region are essential for productive infection, likely by facilitating crucial steps in the viral lifecycle beyond simple VP1 association.

What is the role of VP2 in viral entry and capsid disassembly?

VP2 plays critical roles in polyomavirus entry and capsid disassembly:

  • During viral entry, inter-pentamer disulfide bonds in VP1 are oxidized by host enzymes, leading to dissociation of pentavalent VP1 pentamers and exposure of VP2/3 .

  • Inhibition of VP2/3 exposure indicates improper trafficking or disassembly of the virus .

  • Treatment with D1 peptide (derived from VP2/3) prevents proper capsid disassembly and exposure of minor structural protein epitopes, indicating the importance of VP2-VP1 interactions in this process .

  • VP2 likely contributes to membrane penetration during viral entry, as suggested by its interaction with cellular membranes and exposure during specific stages of infection .

These findings suggest that VP2 functions not only in virion assembly but also critically in early stages of infection, making it a potential target for antiviral strategies that disrupt viral entry.

What is the role of Bovine polyomavirus VP2 in viral pathogenesis?

Bovine Polyomavirus 2 (BoPyV2) has been implicated in non-suppurative encephalitis in cattle, with viral nucleic acid detected in brain samples from affected animals . While the specific contribution of VP2 to pathogenesis has not been fully elucidated, several lines of evidence suggest its importance:

  • BoPyV2 viral nucleic acid was detected by in situ hybridization in all brain areas examined from cattle with neurological disease, particularly in areas showing signs of inflammation .

  • The presence of viral material coincided mainly with nuclei in samples from affected animals, consistent with the nuclear phase of polyomavirus replication .

  • By analogy with other polyomaviruses, VP2 likely plays essential roles in viral entry, trafficking, and possibly immune evasion during infection .

The strong association between BoPyV2 and non-suppurative encephalitis suggests that VP2, as an essential viral protein, contributes to neurological pathogenesis, possibly through its roles in viral entry into neuronal or glial cells.

How can recombinant VP2 be used to study polyomavirus tissue tropism?

Recombinant VP2 offers valuable approaches for investigating polyomavirus tissue tropism:

  • Interaction studies with tissue-specific cellular receptors or co-factors to identify determinants of viral entry into specific cell types.

  • Cell binding assays using labeled recombinant VP2 to map differential binding to various cell types, potentially identifying tropism factors.

  • Trans-complementation experiments where VP2-deficient viral particles are complemented with recombinant VP2 variants to assess restoration of infectivity in different tissues.

  • Development of detection tools such as antibodies against VP2 for immunohistochemical studies to track viral distribution in tissues, as demonstrated in brain samples from cattle with encephalitis .

  • Creation of virus-like particles incorporating VP2 variants to study entry into different cell types without requiring infectious virus.

These approaches can help elucidate the contribution of VP2 to the neurotropism observed with BoPyV2 in cattle encephalitis cases.

What controls should be included in VP2 mutagenesis and interaction studies?

When conducting VP2 mutagenesis and interaction studies, the following controls are essential:

These controls help distinguish between direct effects of specific amino acid changes versus indirect effects caused by misfolding or mislocalization of mutant proteins.

How can I optimize detection of VP2 in tissue samples for disease studies?

Detection of VP2 in tissue samples requires optimized protocols:

  • PCR-based detection:

    • Use multiple primer pairs targeting conserved regions of VP2, as demonstrated in studies of BoPyV2 in cattle brain samples

    • Include appropriate negative controls to rule out contamination

    • Consider nested PCR approaches for increased sensitivity

  • In situ hybridization (ISH):

    • Target highly conserved regions of the VP2 gene

    • The binding region should be carefully selected based on sequence conservation and accessibility

    • Signal detection is expected to have predominantly nuclear or perinuclear localization

    • Compare with areas showing histopathological changes to correlate viral presence with lesions

  • Immunohistochemistry:

    • Use antibodies generated against recombinant VP2 that specifically recognize both recombinant and virion VP2/VP3

    • Include both fresh frozen and formalin-fixed paraffin-embedded (FFPE) tissues when possible

    • Complement with double labeling for cellular markers to identify infected cell types

  • Next-generation sequencing (NGS):

    • Valuable for detection and full-genome sequencing when viral load is sufficient

    • Can identify novel polyomavirus variants in clinical samples

These approaches should be used complementarily for comprehensive detection and characterization of VP2 in disease-associated tissues.

What are common pitfalls in working with recombinant polyomavirus VP2 and how can they be addressed?

Common challenges and solutions when working with recombinant VP2 include:

ChallengeSolutionRationale
Poor solubilityCo-express with VP1VP2 is naturally found in complex with VP1, which may enhance solubility
Low expression levelsUse codon-optimized sequencesEnhances translation efficiency in the expression host
Protein aggregationExpress truncated forms focusing on functional domainsThe C-terminal segment of VP2/VP3 can be expressed and purified more readily than full-length protein
Degradation during purificationAdd protease inhibitors and minimize purification timeProteolysis can be a major issue with viral proteins
Non-specific binding in interaction studiesInclude stringent washing steps and appropriate controlsVP2 may have hydrophobic regions that promote non-specific interactions
Difficulty detecting VP2 in immunoassaysGenerate antibodies against recombinant VP2Ensures specific detection of both recombinant and native viral VP2
Poor reproducibility in functional assaysStandardize VP2:VP1 ratiosThe stoichiometry of VP2:VP1 (1:5) is critical for proper complex formation and function

Addressing these challenges requires careful optimization of expression conditions, purification protocols, and validation assays to ensure that recombinant VP2 maintains native-like properties.

How might structural studies of VP2 inform polyomavirus vaccine development?

Structural studies of VP2-VP1 interactions provide critical insights for polyomavirus vaccine development:

  • The crystal structure of VP2 C-terminal segment complexed with VP1 pentamer at 2.2 Å resolution reveals specific contact points that could be targeted in structure-based vaccine design .

  • Highly conserved regions of VP2 across polyomaviruses could serve as targets for broad-spectrum vaccines .

  • Understanding that a single copy of VP2 interacts with a VP1 pentamer informs the design of virus-like particles with appropriate stoichiometry for optimal immunogenicity .

  • The identification of D1 peptide from VP2/3 that inhibits viral infection by targeting the VP1 pore suggests potential epitopes for neutralizing antibodies .

  • Mutational analysis revealing residues critical for VP2-VP1 interaction and viral infectivity highlights key targets for vaccine-induced immunity .

These structural insights can guide the development of subunit vaccines, virus-like particles, or peptide vaccines targeting conserved, functionally critical regions of VP2 and its interaction with VP1.

What emerging technologies might advance our understanding of VP2 function?

Several cutting-edge technologies show promise for elucidating VP2 function:

  • Cryo-electron tomography: Could reveal the organization of VP2 within intact virions at different stages of the viral lifecycle with higher resolution than previously possible.

  • Single-molecule imaging techniques: May track VP2-VP1 interactions in real-time during viral assembly and entry.

  • CRISPR-Cas9 genome editing: Enables precise manipulation of VP2 in the viral genome for functional studies in relevant cell types.

  • Protein engineering approaches: Could produce stable, soluble variants of VP2 for structural and functional studies without requiring complex formation with VP1.

  • High-throughput mutagenesis and phenotyping: Allows comprehensive mapping of structure-function relationships in VP2.

  • In situ structural biology methods: Emerging techniques that determine protein structures within cells may reveal conformational changes in VP2 during different stages of infection.

These technologies, particularly when used in combination, have the potential to resolve longstanding questions about the dynamic roles of VP2 in polyomavirus biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.