Recombinant Bovine Potassium voltage-gated channel subfamily D member 1 (KCND1)

Shipped with Ice Packs
In Stock

Description

Overview of Human KCND1

KCND1 encodes the α-subunit of Kv4.1, a voltage-gated potassium channel critical for rapidly inactivating A-type currents in neurons and cardiac cells . It modulates action potential repolarization and neuronal excitability .

Key Properties of Recombinant Human KCND1:

PropertyDetails
Expression SystemYeast
Protein LengthPartial sequence (410–647 amino acids, cytoplasmic domain)
Molecular Weight27.7–29.8 kDa
Purity>90% (SDS-PAGE)
FunctionForms A-type potassium channels; regulates I(To) in heart and I(Sa) in neurons

Research Findings on Human KCND1

  • Pathogenic Variants: Hemizygous KCND1 variants are linked to X-linked neurodevelopmental disorders with neuropsychiatric features and epilepsy .

  • Channel Dynamics: KCND1’s biophysical properties are modulated by auxiliary β-subunits (e.g., KChIP2b, DPP6) .

  • Disease Associations:

    • Cortical dysplasia with intractable epilepsy .

    • Altered proliferation in tumorigenic mammary epithelial cells .

Functional Characterization

KCND1 variants alter channel inactivation kinetics and voltage dependence when expressed in Xenopus laevis oocytes . For example:

  • p.Arg328Cys: Slowed inactivation and hyperpolarizing shift in voltage dependence .

  • p.Arg419Trp: Reduced current density and accelerated recovery from inactivation .

Limitations and Recommendations

The query’s focus on bovine KCND1 cannot be addressed with current data. To proceed:

  1. Verify if the intended target is human KCND1 (well-characterized).

  2. Explore bovine genome databases for KCND1 homologs, as none are documented in the provided sources.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
KCND1; Potassium voltage-gated channel subfamily D member 1; Voltage-gated potassium channel subunit Kv4.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-648
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
KCND1
Target Protein Sequence
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR YPDTLLGSSEKEFFYNADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGDGPTLPAGSSLRQRLWRAFENPH TSTAALVFYYVTGFFIAVSVIANVVETIPCRSPTRRPPREQPCGDRFPLAFFCMDTACVL IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFMPKNEDVSGAFVTLRVFRVF RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGSLEDSGGGEEQALCVRNRSAFEQQHHH LLHCLEKTTCHEFTDELTFSEALGAVSLGSRTSRSTSVSSQPVGAGSLLSSCCPRRAKRR AIRLANSTASVSRGSMQELDTLAGLRRSPAPQSRSSLNAKPHDSLDLTCDSRDFVAAIIS IPTPPANTPDESQPSSPGGGGGGASSTLRNSSLGTPCLLPETVKISSL
Uniprot No.

Target Background

Function
The pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. It potentially contributes to I(To) current in the heart and I(Sa) current in neurons. Channel characteristics are influenced by interactions with other alpha subunits and regulatory subunits.
Database Links

KEGG: bta:518384

STRING: 9913.ENSBTAP00000011882

UniGene: Bt.8644

Protein Families
Potassium channel family, D (Shal) (TC 1.A.1.2) subfamily, Kv4.1/KCND1 sub-subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, dendrite.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.