Recombinant Bovine Potassium voltage-gated channel subfamily V member 1 (KCNV1)

Shipped with Ice Packs
In Stock

Description

Definition and Overview

Recombinant Bovine KCNV1 is a genetically engineered form of the potassium voltage-gated channel subunit Kv8.1, produced using Escherichia coli expression systems. Unlike other potassium channels, KCNV1 cannot form functional homotetramers but modulates the activity of outward rectifier channels like KCNB1 and KCNB2 by altering their inactivation thresholds and kinetics .

Functional Properties

  • Channel Modulation: Forms heterotetramers with Kv2 subunits (e.g., KCNB1), shifting inactivation thresholds to more negative potentials and slowing inactivation rates .

  • Trafficking Inhibition: Downregulates surface expression of KCNB1, KCNB2, KCNC4, and KCND1 by sequestering them in intracellular membranes .

  • Neurological Role: Predominantly expressed in the brain, influencing neuronal excitability and neurotransmitter release .

Research Applications

Recombinant Bovine KCNV1 is utilized in:

  • Mechanistic Studies: Investigating potassium channel dynamics and inactivation mechanisms .

  • Disease Modeling: Linked to schizophrenia (via genetic variations) and congenital capillary malformations .

  • Structural Biology: Crystallization and electrophysiological assays to map channel interactions .

Key Assays:

ApplicationExperimental UseSource
Western BlotConfirming protein expression and purity (>90%)
ElectrophysiologyCharacterizing Kv2/Kv8.1 heterotetramer activity
Protein InteractionIdentifying binding partners via pull-down assays

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We strive to determine the tag type during production. If you have a specific tag type in mind, please communicate it to us, and we will prioritize development accordingly.
Synonyms
KCNV1; Potassium voltage-gated channel subfamily V member 1; Voltage-gated potassium channel subunit Kv8.1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-503
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
KCNV1
Target Protein Sequence
MELLPPRGRAPPDSSLDSASLTSLDSSVFCSEGEGEPLALGDSFTVNVGGSRFVLSQQAL SCFPHTRLGKLAVVVASCRRRGALAAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQ HESEQDFSQGRCPTIRQKLWNILEKPGSCTAARIFGVISIIFVAVSIVNMALMSAELSWL DPQLLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSG SQTTQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI SIFSTVEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIM EMLRLKGRERASTRSSGGDDFWF
Uniprot No.

Target Background

Function
Potassium channel subunit that does not form functional channels independently. It modulates the activity of KCNB1 and KCNB2 channels by shifting the inactivation threshold to more negative values and slowing down the inactivation rate. It can downregulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, possibly by retaining them within intracellular membranes.
Database Links
Protein Families
Potassium channel family, V (TC 1.A.1.2) subfamily, Kv8.1/KCNV1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is KCNV1 and how does it function in neuronal systems?

KCNV1, also known as Kv8.1, is classified as a "silent" potassium channel subunit that cannot form functional homomeric channels independently. Instead, it forms heteromeric complexes with other Kv channels, particularly those in the Kv2 family. When co-expressed with Kv2 channels, KCNV1 modulates their activity by shifting the threshold for inactivation to more negative values and slowing the inactivation rate. This regulatory function is crucial in fine-tuning neuronal responses, as KCNV1 can effectively down-regulate the channel activity of KCNB1, KCNB2, KCNC4, and KCND1, possibly by trapping them in inactive complexes. Despite not directly contributing to membrane excitability, KCNV1 plays a significant role in neuronal health and metabolism.

How does the structure of KCNV1 differ from other potassium channels?

KCNV1 exhibits the typical structural elements of voltage-gated potassium channels, including six transmembrane domains, but with distinct modifications that render it electrically silent as a homomer. The protein is approximately 500 amino acids in length with the transmembrane regions forming the ion conduction pathway. While sharing structural similarities with functional potassium channels like KCNQ1, KCNV1's unique structural features prevent it from forming functional homomeric channels. The protein contains specific domains that facilitate interaction with Kv2 family channels, allowing it to form functional heteromeric complexes that possess unique biophysical properties compared to homomeric channels. These structural differences enable KCNV1 to serve as a modulator rather than an independent ion channel.

What is known about the tissue-specific expression pattern of KCNV1?

KCNV1 belongs to the electrically silent KvS subunit family and exhibits a relatively restricted expression pattern predominantly in the brain. This limited distribution distinguishes it from more ubiquitously expressed potassium channels. The tissue-specific expression of KCNV1 suggests specialized roles in neuronal function. When KCNV1 forms heteromeric channels with Kv2 subunits, these complexes display unique biophysical properties and more tissue-specific expression patterns compared to homomeric channels, making them potentially valuable targets for pharmacological interventions with higher specificity. Understanding the precise distribution of KCNV1 across different cell types within the brain remains an active area of research.

What expression systems are most effective for producing recombinant bovine KCNV1?

For recombinant bovine KCNV1 production, mammalian expression systems typically yield the most physiologically relevant protein. HEK293 and CHO cells are preferred for functional studies as they provide appropriate post-translational modifications and trafficking mechanisms. For structural studies requiring larger protein quantities, insect cell systems using baculovirus vectors (Sf9 or Hi5 cells) offer a compromise between proper folding and higher expression levels. When designing expression constructs, researchers should consider including purification tags (His, FLAG, or Strep) positioned to avoid interference with channel assembly. The expression vector should contain a strong promoter (CMV for mammalian cells, polyhedrin for insect cells) and appropriate selection markers. Co-expression with Kv2 family members may be necessary for functional studies since KCNV1 requires partners to form functional channels.

What purification strategies yield the highest purity and functional integrity of recombinant KCNV1?

Purification of recombinant bovine KCNV1 requires specialized approaches to maintain the integrity of this transmembrane protein. Begin with gentle solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin rather than harsh ionic detergents. Implement a two-step chromatography approach, starting with affinity chromatography (nickel-NTA for His-tagged constructs) followed by size exclusion chromatography to separate properly assembled channels from aggregates. Throughout purification, maintain a detergent concentration above the critical micelle concentration and consider adding lipids or using amphipols for stabilization. For co-purification with Kv2 family members, design constructs with different affinity tags to verify complex formation. Quality control should include SDS-PAGE, Western blotting, and functional verification through reconstitution in lipid bilayers or proteoliposomes for electrophysiological measurements.

How can researchers verify the proper folding and assembly of recombinant bovine KCNV1?

Verification of proper folding and assembly of recombinant bovine KCNV1 requires a multi-faceted approach. Begin with biophysical characterization using techniques such as circular dichroism (CD) spectroscopy to assess secondary structure content and thermal stability measurements to evaluate protein stability. Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) helps determine the oligomeric state and homogeneity of the preparation. For functional verification, co-expression studies with Kv2 family channels followed by electrophysiological measurements are essential, as KCNV1 itself does not form functional homomeric channels. Patch-clamp recordings should demonstrate the characteristic modulation of Kv2 channel properties, including shifted inactivation thresholds and slowed inactivation kinetics. Additionally, binding assays with known interaction partners can confirm proper folding. Cryo-electron microscopy or cross-linking mass spectrometry can provide structural insights into heteromeric assembly.

What are the most reliable methods for studying KCNV1-Kv2 interactions?

To study KCNV1-Kv2 interactions effectively, employ a combination of co-immunoprecipitation, FRET/BRET, and electrophysiological approaches. For co-immunoprecipitation, use differentially tagged constructs (e.g., FLAG-tagged KCNV1 and HA-tagged Kv2.1) and verify complex formation under different detergent conditions. FRET/BRET techniques with fluorescently labeled constructs can confirm interactions in live cells and provide dynamic information. Electrophysiological characterization is essential - compare properties of Kv2 channels expressed alone versus co-expressed with KCNV1 using patch-clamp recording. Key parameters to measure include activation and inactivation voltage dependencies, kinetics of activation/inactivation, and current density. Additionally, implement proximity labeling approaches such as BioID or APEX to identify the interactome of KCNV1 in native contexts. Single-molecule techniques like single-molecule pull-down (SiMPull) can determine the stoichiometry of KCNV1-Kv2 complexes.

How can researchers functionally characterize the modulatory effects of KCNV1 on Kv2 channels?

The functional characterization of KCNV1's modulatory effects on Kv2 channels requires systematic electrophysiological analysis. Establish heterologous expression systems with controlled ratios of KCNV1 to Kv2 subunits (typically Kv2.1 or Kv2.2) and perform whole-cell patch-clamp recordings to generate comprehensive current-voltage relationships. Specifically measure: (1) shifts in the voltage-dependence of activation and inactivation using standard voltage protocols, (2) changes in activation and inactivation kinetics across various membrane potentials, (3) alterations in current density, and (4) recovery from inactivation time course. Compare these parameters between Kv2 channels expressed alone versus with KCNV1. Additionally, implement site-directed mutagenesis of key KCNV1 residues to identify molecular determinants of modulation. For more physiologically relevant contexts, use primary neuronal cultures with KCNV1 knockdown/overexpression followed by current-clamp recordings to assess effects on action potential waveforms and neuronal excitability.

What approaches can be used to investigate the role of KCNV1 in neuronal metabolism and lipid/protein transport?

Recent research indicates KCNV1 influences neuronal metabolism and lipid/protein transport independent of its effects on excitability. To investigate these non-canonical functions, employ a multi-omics approach comparing wild-type neurons with KCNV1 knockout or knockdown models. Perform lipidomic profiling using LC-MS/MS to identify changes in membrane lipid composition and metabolomic analysis to detect alterations in key metabolic pathways. For protein transport, implement live-cell imaging with fluorescently tagged cargo proteins and measure trafficking kinetics. Assess mitochondrial function through measurements of oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) using platforms like Seahorse XF. Protein-protein interaction studies focusing on non-channel partners of KCNV1 can reveal novel connections to metabolic and trafficking machinery. Finally, conduct transcriptomic analysis to identify gene expression changes in metabolic and transport pathways. These approaches collectively provide insights into how KCNV1 impacts neuronal health beyond its channel modulatory functions.

How does KCNV1 dysregulation contribute to neurological disorders?

KCNV1 dysregulation has been implicated in several neurological conditions through both direct and indirect mechanisms. Common variations in the KCNV1 gene have been associated with schizophrenia, suggesting its role in maintaining proper neuronal function. Research into amyotrophic lateral sclerosis (ALS) models has shown that downregulation of KCNV1 in motor neurons increases their vulnerability to cell death induced by proteotoxic stress. This occurs without altering neuronal excitability, indicating that KCNV1's protective effects operate through mechanisms separate from its ion channel modulatory functions. The precise pathways may involve metabolic regulation, protein trafficking, or cellular stress responses. To investigate these connections, researchers should implement disease-specific models with KCNV1 manipulation, followed by comprehensive phenotypic characterization including stress resistance assays, proteostasis measurements, and assessment of cell survival pathways. Understanding these mechanisms provides potential therapeutic targets for neurological disorders with KCNV1 involvement.

What experimental protocols are most effective for studying KCNV1 in neurodegenerative disease models?

When studying KCNV1 in neurodegenerative disease contexts, employ a tiered experimental approach. Begin with in vitro models using iPSC-derived motor neurons from patients with conditions like ALS and compare KCNV1 expression levels with controls. For manipulation studies, use CRISPR/Cas9 gene editing to create isogenic lines with KCNV1 knockout or shRNA for acute knockdown. Challenge these neurons with disease-relevant stressors (such as proteasome inhibitors like MG132 for models of protein aggregation diseases) and assess survival, morphology, and functional parameters. For in vivo studies, develop conditional KCNV1 knockout mouse models using neuron-specific Cre drivers, and characterize phenotypes including behavioral assessments, electrophysiology, and histopathological examination. To better understand KCNV1's role in proteostasis, implement protein aggregation assays, measure ubiquitin-proteasome system activity, and conduct unbiased proteomics to identify altered protein networks. Longitudinal studies tracking disease progression with and without KCNV1 modulation provide insights into therapeutic potential.

How can researchers differentiate between the channel-dependent and channel-independent functions of KCNV1?

Differentiating between channel-dependent and channel-independent functions of KCNV1 requires strategic experimental design. First, generate structure-function mutants: create KCNV1 constructs with mutations in the pore region that abolish channel modulation while preserving protein-protein interactions, and constructs with mutations in protein interaction domains that maintain channel modulatory function. Express these in appropriate neuronal models and assess: (1) electrophysiological parameters to confirm channel modulation status, (2) cell viability under stress conditions like MG132 treatment, (3) metabolic function through Seahorse analysis, and (4) protein/lipid transport using fluorescent reporters. Additionally, perform interactome analysis on wild-type versus mutant KCNV1 to identify differential binding partners. Time-resolved studies after acute KCNV1 manipulation can distinguish immediate effects (likely channel-dependent) from delayed responses (potentially channel-independent). Finally, implement pharmacological approaches using Kv2-specific modulators to determine whether channel activity correlates with observed phenotypes. This comprehensive approach helps delineate the diverse functional roles of KCNV1 in neuronal physiology and pathology.

What strategies can optimize the stability of recombinant bovine KCNV1 for structural studies?

For structural studies of recombinant bovine KCNV1, implement a systematic stabilization approach. First, optimize the construct design by identifying and removing flexible regions through limited proteolysis coupled with mass spectrometry, while preserving functional domains. Test multiple fusion partners (e.g., T4 lysozyme, BRIL) inserted into flexible loops to enhance crystallizability. For membrane protein stabilization, screen a comprehensive panel of detergents beyond standard options, including novel neopentyl glycol detergents, which often provide superior stability. Implement thermal stability assays (CPM, nanoDSF) to quantitatively assess construct stability across conditions. Consider lipid supplementation during purification, specifically testing native-like lipid mixtures versus defined lipids like phosphatidylcholine and phosphatidylglycerol. For cryo-EM studies, evaluate reconstitution in nanodiscs with varying MSP constructs and lipid compositions. Co-expression with Kv2 family fragments or stabilizing antibodies/nanobodies can lock the complex in defined conformational states. Finally, implement surface engineering through strategic mutation of surface-exposed residues to reduce conformational heterogeneity.

How can researchers develop specific antibodies or nanobodies against bovine KCNV1?

Developing specific antibodies or nanobodies against bovine KCNV1 requires careful antigen design and validation strategies. Begin by identifying unique epitopes in the bovine KCNV1 sequence that differ from other species and channel subtypes, focusing on extracellular loops and N/C-terminal regions. For conventional antibodies, use a multi-format antigen approach: (1) recombinant protein fragments expressed in E. coli, (2) synthetic peptides conjugated to carrier proteins, and (3) DNA immunization with full-length bovine KCNV1. For nanobody development, immunize camelids with detergent-solubilized purified protein or reconstituted proteoliposomes containing KCNV1-Kv2 complexes. During screening, implement stringent counter-selection against related channels and cross-species variants to ensure specificity. Validation should include Western blotting, immunoprecipitation, and immunocytochemistry with appropriate knockout controls. Functional validation is crucial - test whether the antibodies/nanobodies affect the modulatory function of KCNV1 on Kv2 channels using electrophysiological recordings. Finally, epitope mapping using hydrogen-deuterium exchange mass spectrometry or site-directed mutagenesis confirms binding sites and informs functional interpretation.

What computational approaches can predict the interaction interface between KCNV1 and Kv2 channels?

To predict the interaction interface between KCNV1 and Kv2 channels, implement a multi-scale computational approach. Begin with homology modeling of bovine KCNV1 using the recently determined structures of related potassium channels as templates. For Kv2 channels, utilize available structural data on voltage-gated potassium channels to build accurate models. Perform protein-protein docking using software packages like HADDOCK, ClusPro, or Rosetta, incorporating any available experimental constraints from crosslinking or mutational studies. Refine these models through molecular dynamics simulations in explicit membrane environments, running multiple replicates of 100-500 ns to ensure adequate sampling of conformational space. Analyze the stability of predicted interfaces through contact analysis, binding free energy calculations, and identification of key interaction residues. Machine learning approaches trained on known channel-subunit interfaces can provide additional predictions. Implement coevolutionary analysis if sufficient sequence data is available across species, using methods like direct coupling analysis to identify co-evolving residues that likely form contacts. Finally, generate testable hypotheses for experimental validation through structure-guided mutagenesis of predicted interface residues.

How can researchers overcome common challenges in heterologous expression of KCNV1-Kv2 complexes?

When expressing KCNV1-Kv2 complexes in heterologous systems, researchers often encounter issues with stoichiometry control, trafficking, and functional assessment. To address these challenges, implement a multi-faceted approach. For stoichiometry control, use bicistronic or multicistronic vectors with different promoter strengths to adjust relative expression levels. Alternatively, employ the T2A peptide system to ensure equimolar production of both subunits. If membrane trafficking is problematic, screen multiple cell types (HEK293, CHO, Neuro2A) as different backgrounds may provide varying trafficking machinery. Consider including trafficking-enhancement tags or temperature manipulation (cultivation at 30°C instead of 37°C) to improve surface expression. For functional assessment, implement automated high-throughput electrophysiology platforms to systematically optimize expression conditions. If current levels remain low, test co-expression with ancillary subunits that might enhance trafficking or modify folding characteristics. Finally, develop fluorescent protein-tagged constructs to visually monitor expression, localization, and relative abundance of each component, enabling real-time optimization of expression conditions.

What quality control measures ensure the biological relevance of recombinant KCNV1 studies?

Ensuring biological relevance in recombinant KCNV1 studies requires comprehensive quality control measures. First, verify sequence integrity through complete sequencing of expression constructs, paying special attention to transmembrane domains and interaction sites. Confirm protein identity and integrity via mass spectrometry, ensuring no unexpected modifications or truncations. Assess protein homogeneity through size exclusion chromatography and dynamic light scattering, establishing monodispersity criteria before proceeding with functional studies. For functional validation, systematically compare the modulatory effects of recombinant KCNV1 on Kv2 channels with established literature values, particularly focusing on biophysical parameters like voltage-dependent inactivation and activation kinetics. Implement concentration-response relationships to ensure the observed effects follow expected stoichiometric principles. Compare results across multiple expression systems, and when possible, validate key findings in primary neuronal cultures. For bovine-specific studies, compare with rodent or human orthologs to identify any species-specific functional differences. Finally, establish reproducibility through biological replicates from independent protein preparations and standardized protocols for electrophysiological or biochemical assessments.

How can researchers address the challenges of studying KCNV1 in native neuronal contexts?

Studying KCNV1 in native neuronal contexts presents unique challenges due to its modulatory nature and co-expression with various channel partners. Implement a systematic approach beginning with validated antibodies for immunolocalization studies, using KCNV1 knockout controls to confirm specificity. For functional studies in neurons, combine selective pharmacological tools targeting Kv2 channels with KCNV1 genetic manipulation (knockout/knockdown) to isolate KCNV1-dependent effects. Design patch-clamp protocols that isolate Kv2-mediated currents using appropriate voltage protocols and pharmacological isolation. When interpreting results, account for compensatory mechanisms that may emerge following chronic KCNV1 manipulation by implementing inducible or acute manipulation systems. For single-cell transcriptomic correlation studies, analyze co-expression patterns of KCNV1 with various Kv channel partners across neuronal subtypes. In neuronal cultures, implement compartment-specific analysis (soma vs. dendrites vs. axon) to understand location-dependent functions. Finally, develop organoid models from species-relevant stem cells to create more physiological three-dimensional environments for studying KCNV1 function in complex neural networks.

Key Properties of Bovine KCNV1 Compared to Other Species
Property
----------
Amino Acid Length
Transmembrane Domains
Primary Expression
Functional Status
Primary Channel Partners
Modulation Effect

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.