Recombinant Bovine PRA1 family protein 2 (PRAF2)

Shipped with Ice Packs
In Stock

Description

Protein Transport Regulation

PRAF2 acts as a "gatekeeper" for chemokine receptors like CCR5, retaining them in the ER via transmembrane domain interactions . This contrasts with CD4, which promotes CCR5 plasma membrane export . In vesicular traffic, PRAF2 interacts with Rab GTPases and modulates ER/Golgi trafficking pathways .

Apoptosis Modulation

PRAF2 binds anti-apoptotic proteins Bcl-xL and Bcl-2 through their transmembrane domains, counteracting their survival signals . Overexpression induces apoptosis by triggering Bax mitochondrial translocation and caspase activation, which is inhibited by wild-type Bcl-xL but not its transmembrane domain-deleted mutant .

Viral Interactions

PRAF2 binds HPV E5 oncoprotein, with amino acids 135–160 critical for interaction . This interaction may disrupt viral lifecycle processes, such as E1^E4 expression in organotypic rafts .

Research Applications

Recombinant bovine PRAF2 is utilized in:

  1. Cell-Surface Protein Localization Studies: BRET assays to monitor CCR5 retention in the ER .

  2. Apoptosis Pathway Analysis: Co-immunoprecipitation (Co-IP) and PARP cleavage assays to assess pro-apoptotic activity .

  3. Viral Oncology Research: Proximity-dependent biotinylation (BioID) to map interactomes with HPV E5 .

ApplicationMethodKey Finding
CCR5 LocalizationBRET, Co-IPPRAF2 inhibits CCR5 export via TM domain
Apoptosis InductionPARP Cleavage, Annexin VBcl-xL blocks PRAF2-mediated cell death
Viral InteractomeBioID, Mass SpectrometryPRAF2 interacts with HPV E5 and EGFR

Cancer and Therapeutic Relevance

PRAF2 overexpression is linked to poor prognosis in hepatocellular carcinoma, glioblastoma, and neuroblastoma . In cervical cancer models, its knockdown reduces colony formation and migration, suggesting oncogenic potential . Conversely, its pro-apoptotic activity in normal cells highlights therapeutic potential for targeting apoptosis-resistant cancers .

Experimental Considerations

  • Expression Systems: Recombinant PRAF2 is produced in S2 insect cells or mammalian systems (e.g., HEK293) .

  • Antibodies: Polyclonal rabbit antibodies (e.g., Sigma-Aldrich ABC95) target native and recombinant PRAF2 for Western blot and immunohistochemistry .

  • Species Cross-Reactivity: Bovine PRAF2 antibodies show predicted reactivity with human, mouse, and rat proteins .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is established during production. If you require a particular tag, please inform us, and we will prioritize developing it.
Synonyms
PRAF2; PRA1 family protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-178
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
PRAF2
Target Protein Sequence
MSEVRLPPLRALDDFVLGSARLVAPDPCDPQRWCHRVINNLLYYQTNYLICFGLGLALAG YVRPLHTLLSALVVAVALGMLVCAAENRAAVRRCRRSHPAACLAAVLAVGFLVLWAAGGA GTFLLSIAGPVLLILVHASLRLRNLKNKIENKIESIGLKRTPMGLLLEALGQEQEAGS
Uniprot No.

Target Background

Function
PRAF2 may play a role in ER/Golgi transport and vesicular trafficking. It exhibits pro-apoptotic activity in cerulenin-induced neuroblastoma apoptosis.
Database Links
Protein Families
PRA1 family
Subcellular Location
Endosome membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.