Recombinant Bovine PRA1 family protein 3 (ARL6IP5)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine PRA1 Family Protein 3 (ARL6IP5)

Recombinant bovine PRA1 family protein 3 (ARL6IP5), also known as ADP-ribosylation factor-like 6 interacting protein 5, is a microtubule-associated protein critical for cellular processes such as glutamate transport regulation, cytoskeletal organization, and vesicular trafficking. This recombinant protein is engineered for research applications, enabling studies on its functional roles in bovine models or comparative analyses with other species.

Product Overview

Recombinant bovine ARL6IP5 is available in two forms:

AttributeFull-LengthPartial
Expression HostE. coli E. coli, Yeast, Baculovirus, or Mammalian Cells
TagHis-tag Not specified
Purity>90% (SDS-PAGE) ≥85% (SDS-PAGE)
Protein LengthFull-length (1–188 aa) Partial sequence
FormLyophilized powder Lyophilized powder
ApplicationsSDS-PAGE, protein interaction studies General biochemical assays

The full-length protein retains the native structure for functional studies, while partial versions may focus on specific domains.

Biochemical Functions

ARL6IP5 interacts with pathways critical for:

FunctionRelated Proteins/Pathways
Protein BindingSLC1A1, CCR5, RNF185
C-Terminus BindingMicrotubule-associated proteins
Molecular RolesInhibits glutamate transporter EAAC1 , regulates MMP-9 via CCR5

Key Mechanisms

Comparative Analysis

SpeciesFunctionRelevance to Bovine Models
HumanTumor suppressor (PRAF3) Bovine homolog may mirror roles in cancer research
RatRetinoic acid-responsive differentiation Potential for studying bovine development
MouseNeuroprotection, enhanced learning May inform cattle neurobiology studies

Applications in Research

Recombinant bovine ARL6IP5 is utilized in:

  1. Protein Interaction Studies: Co-IP or pull-down assays to map binding partners (e.g., CCR5, SLC1A1) .

  2. Enzymatic Assays: Evaluating inhibition of glutamate transport or MMP activity. 3

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All protein shipments are made with standard blue ice packs. If dry ice packaging is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquotation is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARL6IP5; PRAF3; PRA1 family protein 3; ADP-ribosylation factor-like protein 6-interacting protein 5; ARL-6-interacting protein 5; Aip-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
ARL6IP5
Target Protein Sequence
MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISVVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDILRRMKKQYPTAFVMVVMLASYFLISLFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEEIGLKRTPMGIVLDALEQQEETITKFS DYISKMKE
Uniprot No.

Target Background

Function
This protein regulates intracellular concentrations of taurine and glutamate. It negatively modulates SLC1A1/EAAC1 glutamate transport activity by reducing its affinity for glutamate in a PKC activity-dependent manner. Furthermore, it plays a role in retaining SLC1A1/EAAC1 in the endoplasmic reticulum.
Database Links
Protein Families
PRA1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm. Cytoplasm, cytoskeleton.

Q&A

What is ARL6IP5 and what are its primary functions?

ARL6IP5, also known as PRA1 family protein 3, is a protein that contains a prenylated Rab acceptor motif involved in intracellular protein transport regulation. Its expression is affected by vitamin A, and it may be associated with the cytoskeleton. The protein plays significant roles in several cellular processes, including regulation of cell differentiation, inhibition of glutamate transporter EAAC1, and involvement in the endoplasmic reticulum (ER) stress response pathway. It also functions as a repair protein in oxidative stress-induced DNA single-strand breaks in fibroblasts through regulation of XRCC1 via the MAPK signal pathway .

What cellular pathways involve ARL6IP5?

ARL6IP5 participates in multiple cellular pathways that are crucial for neuronal function and cellular stress responses. Key pathways include:

Pathway NameRelated ProteinsFunctional Significance
Glutamate Neurotransmitter Release CycleUNC13B, RAB3AB, SYT1A, SNAP25B, SLC1A2A, SLC1A3BRegulation of glutamate transport and signaling
Neuronal SystemKCNC1B, KCND2, KCNJ14, PANX1, KCNV1Modulation of neuronal activity and signaling
Transmission across Chemical SynapsesSLC18A3A, SNAP25B, SLC1A2A, CACFD1Facilitation of synaptic transmission
Neurotransmitter Release CycleSLC1A2A, SLC1A2B, SYN3, SLC6A1AControl of neurotransmitter release and recycling

ARL6IP5 is particularly important in these pathways through its interaction with glutamate transporters and its role in protein trafficking .

How is ARL6IP5 expression regulated at the cellular level?

ARL6IP5 expression is primarily regulated by vitamin A and its metabolite retinoic acid. Research has demonstrated that retinoic acid upregulates the expression of ARL6IP5, which subsequently leads to a specific reduction in EAAC1-mediated glutamate transport. This regulatory mechanism highlights the importance of ARL6IP5 in glutamatergic neurotransmission.

Additionally, ARL6IP5 expression is compensatorily upregulated in response to chronically activated unfolded protein response (UPR) in cellular stress conditions, such as in prion disease models. This upregulation serves as a protective mechanism against ER stress, suggesting ARL6IP5 plays a crucial role in cellular stress adaptation mechanisms .

What role does ARL6IP5 play in DNA repair mechanisms and cisplatin resistance?

ARL6IP5 functions as a critical regulator of DNA repair mechanisms, particularly in response to cisplatin treatment. Research has identified ARL6IP5 as a novel gene that suppresses cisplatin resistance by:

  • Activating apoptotic pathways in response to DNA damage

  • Inhibiting DNA repair through direct interaction with XRCC1 and PARP1

  • Protecting XRCC1 from ubiquitination and degradation

  • Regulating the MAPK signaling pathway involved in DNA repair

In ovarian cancer models, ARL6IP5 overexpression significantly reduces cisplatin resistance by interfering with these DNA repair mechanisms. Conversely, knockdown of ARL6IP5 enhances cisplatin resistance by allowing more efficient DNA repair through XRCC1 and PARP1 pathways. This mechanism suggests that ARL6IP5 expression levels could serve as a potential biomarker for predicting cisplatin treatment response in certain cancers .

How does ARL6IP5 regulate ER stress and reticulophagy, and what are the implications for neurodegenerative diseases?

ARL6IP5 functions as a novel ER stress regulator by inducing reticulophagy (selective autophagy of the ER) through several mechanisms:

  • Overexpression of ARL6IP5 overcomes ER stress by reducing the expression of chronically activated UPR pathway proteins

  • ARL6IP5 induces reticulophagy to reduce misfolded protein burden (notably PRNP/PrPSc in prion disease models)

  • This process depends on Ca2+-mediated AMPK activation and can induce autophagy even in the presence of 3-MA (an autophagy inhibitor)

  • ARL6IP5-induced reticulophagy involves direct interaction with the soluble reticulophagy receptor CALCOCO1 and lysosomal marker LAMP1

Knockdown of ARL6IP5 leads to inefficient autophagic flux and elevated misfolded protein burden, suggesting its critical role in protein quality control mechanisms. The ability of ARL6IP5 to regulate ER stress and protein misfolding makes it a potential therapeutic target for neurodegenerative diseases, particularly prion diseases, where protein misfolding is a central pathological feature .

What experimental approaches are most effective for studying ARL6IP5-mediated reticulophagy?

To effectively study ARL6IP5-mediated reticulophagy, researchers should consider a multi-faceted experimental approach:

  • Genetic manipulation: Utilize overexpression and knockdown models of ARL6IP5 in relevant cell lines to establish cause-effect relationships.

  • Autophagy flux assays: Monitor autophagosome formation and degradation using:

    • LC3-II conversion assays with and without lysosomal inhibitors

    • Tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) to distinguish early autophagosomes from autolysosomes

    • Co-localization studies of ER markers with autophagy proteins

  • ER stress monitoring: Assess UPR pathway activation through:

    • Western blot analysis of UPR proteins (BiP, PERK, IRE1α, ATF6)

    • XBP1 splicing assays

    • CHOP expression analysis

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of ARL6IP5 with CALCOCO1 and LAMP1

    • Proximity ligation assays to visualize interactions in situ

    • FRET/BRET analyses for dynamic interaction studies

  • Calcium signaling assessment:

    • Live cell calcium imaging using fluorescent indicators

    • Measurement of calcium release from ER stores

    • Analysis of AMPK activation downstream of calcium signaling

  • Functional outcomes measurement:

    • Assessment of misfolded protein clearance (e.g., PrPSc levels)

    • Cell viability and apoptosis assays

    • ER morphology analysis using fluorescence and electron microscopy

How does ARL6IP5 influence glutamate transport and what are the implications for neurological disorders?

ARL6IP5 exerts significant influence on glutamate transport through direct interaction with the glutamate transporter EAAC1 (also known as EAAT3 or SLC1A1). The molecular mechanisms and implications include:

  • Direct inhibition: ARL6IP5 binds and inhibits EAAC1, reducing glutamate uptake capacity in neurons and glial cells.

  • Retinoic acid-mediated regulation: Upregulation of ARL6IP5 by retinoic acid results in specific reduction of EAAC1-mediated glutamate transport, establishing a vitamin A-dependent regulatory mechanism.

  • Subcellular trafficking effects: ARL6IP5 likely affects the membrane localization and recycling of EAAC1, thereby modulating its availability at the cell surface.

  • Implication in excitotoxicity: By regulating glutamate clearance, ARL6IP5 may modulate excitotoxic neuronal damage in conditions like stroke, epilepsy, and neurodegenerative diseases.

  • Potential role in psychiatric disorders: Given the importance of glutamatergic signaling in conditions like schizophrenia, OCD, and anxiety disorders (where EAAC1 has been implicated), ARL6IP5 may represent an unexplored contributor to these conditions .

The relationship between ARL6IP5 and glutamate transport suggests potential therapeutic applications in neurological disorders characterized by glutamatergic dysregulation, pending further investigation in appropriate disease models.

What are the optimal conditions for working with recombinant bovine ARL6IP5 protein?

When working with recombinant bovine ARL6IP5 protein, researchers should implement the following optimized conditions:

What experimental designs are most effective for studying ARL6IP5's role in DNA repair?

To effectively investigate ARL6IP5's role in DNA repair mechanisms, particularly in the context of cisplatin resistance, the following experimental design strategies are recommended:

  • Cell line selection and manipulation:

    • Use paired cisplatin-sensitive and resistant cancer cell lines (e.g., A2780/A2780-CP for ovarian cancer)

    • Generate stable ARL6IP5 overexpression and knockdown models using lentiviral systems

    • Consider CRISPR/Cas9 for complete knockout studies when appropriate

  • DNA damage induction and quantification:

    • Treat cells with cisplatin at IC50 concentrations determined for each cell line

    • Measure DNA damage through comet assay (alkaline conditions for single-strand breaks)

    • Quantify γ-H2AX foci formation through immunofluorescence microscopy

    • Assess platinum-DNA adduct formation using atomic absorption spectroscopy

  • Repair pathway analysis:

    • Monitor DNA repair kinetics by measuring damage markers at different time points post-treatment

    • Specifically assess nucleotide excision repair (NER) pathway activity using host-cell reactivation assays

    • Examine homologous recombination efficiency with DR-GFP reporter assays

  • Protein interaction studies:

    • Perform co-immunoprecipitation of ARL6IP5 with XRCC1 and PARP1

    • Conduct proximity ligation assays to visualize interactions in situ

    • Examine changes in XRCC1 ubiquitination status in the presence/absence of ARL6IP5

  • Signaling pathway analysis:

    • Assess MAPK pathway activation through phosphorylation status of key components

    • Use pathway inhibitors to determine dependency of ARL6IP5 functions on specific signaling cascades

  • Functional outcomes:

    • Measure cell survival and apoptosis following cisplatin treatment

    • Assess colony formation as an indicator of long-term survival

    • Conduct cell cycle analysis to determine checkpoint activation

  • In vivo validation:

    • Establish xenograft models with ARL6IP5-modulated cells

    • Monitor tumor growth in response to cisplatin treatment

    • Analyze tumor samples for DNA repair markers and pathway activation

What are the most reliable techniques for studying ARL6IP5-mediated protein interactions?

Studying ARL6IP5-mediated protein interactions requires a comprehensive approach incorporating multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP):

    • Use either anti-ARL6IP5 antibodies or antibodies against suspected interaction partners

    • Include appropriate controls (IgG control, reverse Co-IP)

    • Enhance detection with crosslinking for transient interactions

    • Consider native Co-IP conditions to preserve physiological complexes

  • Proximity-based methods:

    • Proximity Ligation Assay (PLA) for visualizing interactions in fixed cells with high sensitivity

    • BioID or TurboID for detecting proximal proteins in living cells

    • FRET/BRET for studying dynamic interactions and conformational changes

  • Pull-down assays:

    • Use purified recombinant ARL6IP5 (GST or His-tagged) as bait

    • Perform with cell lysates to identify novel interacting partners

    • Test with purified candidates to confirm direct interactions

    • Include competition assays to assess binding specificity

  • Yeast two-hybrid screening:

    • Use ARL6IP5 as bait to screen for novel interaction partners

    • Validate positive hits with reciprocal tests and other methods

    • Consider membrane yeast two-hybrid for membrane protein interactions

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Determine binding kinetics and affinity constants

    • Assess the effects of mutations on interaction strength

    • Study the impact of post-translational modifications

  • Mass spectrometry-based approaches:

    • Immunoprecipitation coupled with MS for identification of complexes

    • Crosslinking Mass Spectrometry (XL-MS) to map interaction interfaces

    • Hydrogen-Deuterium Exchange MS to study conformational changes upon binding

  • Visualization techniques:

    • Fluorescence colocalization using confocal microscopy

    • Super-resolution microscopy for detailed spatial analysis

    • Live cell imaging with fluorescently-tagged proteins to track dynamic interactions

The combination of these techniques provides a robust framework for characterizing ARL6IP5 interactions with partners such as XRCC1, PARP1, CALCOCO1, and LAMP1, which are crucial for understanding its roles in DNA repair and reticulophagy .

What are the most promising therapeutic applications of ARL6IP5 research?

Based on current understanding of ARL6IP5 functions, several promising therapeutic applications warrant further investigation:

  • Cancer therapy sensitization:

    • Development of small molecules that mimic ARL6IP5's inhibitory effect on DNA repair to enhance cisplatin sensitivity

    • Combination therapy approaches targeting both ARL6IP5 and DNA repair pathways

    • Biomarker development using ARL6IP5 expression levels to predict cisplatin response

  • Neurodegenerative disease interventions:

    • Targeted upregulation of ARL6IP5 to enhance clearance of misfolded proteins in prion diseases

    • Modulation of ARL6IP5-dependent reticulophagy to reduce ER stress in protein misfolding disorders

    • Development of small molecule enhancers of ARL6IP5-CALCOCO1 interaction to boost selective autophagy

  • Glutamatergic system modulation:

    • Fine-tuning of ARL6IP5-EAAC1 interactions to modify glutamate clearance in excitotoxicity-related conditions

    • Development of compounds that modulate ARL6IP5 binding to glutamate transporters

    • Targeted approaches for disorders involving glutamatergic dysfunction

  • ER stress-related pathologies:

    • Leveraging ARL6IP5's role in ER stress regulation for metabolic disorders

    • Exploring applications in ischemia-reperfusion injury where ER stress is prominent

    • Developing cellular resilience enhancement strategies based on ARL6IP5 pathways

Future therapeutic development will require deeper understanding of tissue-specific functions and the development of targeted delivery systems for ARL6IP5-modulating compounds or gene therapies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.