Recombinant Bovine Prenylated Rab acceptor protein 1 (RABAC1)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant bovine RABAC1 is produced using multiple expression systems, with stringent quality control :

ParameterDetails
Host SystemsE. coli, yeast, baculovirus, mammalian cells
TagsGST, His, or untagged variants
Purity≥85% (SDS-PAGE)
FormulationLyophilized with trehalose/mannitol stabilizers in PBS (pH 7.3)

Biochemical Functions

RABAC1 regulates vesicle formation and trafficking through interactions with key partners:

Interaction Partners

PartnerRole
Rab GTPases (e.g., RAB1A, RAB3A)Facilitates vesicle budding and GTPase recycling .
VAMP2Mediates SNARE complex assembly for vesicle fusion .
BCL2A1Inhibits anti-apoptotic activity, inducing caspase-3 activation .

Functional Roles

  • Vesicle Formation: Essential for Golgi-derived vesicle budding by recruiting Rab effectors and SNAREs .

  • Membrane Trafficking: Acts as a GDI dissociation factor, transferring Rab GTPases to membranes .

  • Apoptosis Regulation: Suppresses BCL2A1-mediated survival in cancer cells .

Golgi Trafficking and Mutant Phenotypes

  • Class A Mutants: Retained in the ER, disrupting ER-to-Golgi transport .

  • Class B Mutants: Condense Golgi morphology, inhibit cargo exit, and enhance Rab/VAMP2 binding .

  • Class C Mutants: Exhibit intermediate ER/Golgi localization and reduced Rab binding .

Retinal Development

  • RABAC1 mislocalization in rd1 mice correlates with disrupted Golgi structures and photoreceptor degeneration .

Cancer Therapeutics

  • RABAC1 overexpression in gastric cancer cells inhibits BCL2A1, reducing cell proliferation and migration .

Applications in Research

  • Vesicular Trafficking Studies: Used to investigate Rab GTPase dynamics and SNARE complex assembly .

  • Drug Discovery: Target for BCL2 inhibitor-resistant cancers .

  • Disease Models: Tool for studying retinal degeneration and Golgi-related disorders .

Table 1: Key Biochemical Activities of RABAC1

FunctionRelated Proteins
Identical protein bindingHSPB8, CBX3, APP
Proline-rich region bindingBAIAP2, GHR, CCND1
Protein C-terminus bindingHRAS, PPP1R9B, TNNI3K

Table 2: Expression Systems and Yields

Host SystemYieldTagPurity
E. coliHighGST≥85%
Mammalian cellsModerateHis≥85%

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we suggest adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which serves as a reference point for your considerations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically maintains stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RABAC1; PRAF1; Prenylated Rab acceptor protein 1; PRA1 family protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
RABAC1
Target Protein Sequence
MAVEKDQQKDAEAEGLSAATLLPKLIPSGAGREWLERRRATIRSWGSFVDQRRFSRPRNL GELCQRLVRNVEYYQSNYVFVFLGLILYCVATSPMLLVALAVFFGACYILYLRTLQSKFV LFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEEL QMEPV
Uniprot No.

Target Background

Function
Recombinant Bovine Prenylated Rab acceptor protein 1 (RABAC1) is a general Rab protein regulator crucial for vesicle formation from the Golgi complex. It may regulate vesicle docking and fusion by mediating the interaction of Rab GTPases with SNARE complexes. Additionally, it inhibits the removal of Rab GTPases from the membrane by GDI1.
Database Links
Protein Families
PRA1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm. Golgi apparatus. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle.

Q&A

What is the primary cellular localization pattern of RABAC1?

RABAC1 is predominantly localized to the Golgi complex and post-Golgi vesicles in mammalian cells. Immunohistochemistry studies reveal that RABAC1-like immunoreactivity (RABAC1-LIR) is typically associated with Golgi membranes and the perinuclear region of most cells . In specialized cells like photoreceptors, intense RABAC1-LIR is observed in inner segments where Golgi membranes reside . Additionally, punctate labeling is often detected throughout plexiform layers in retinal tissue, suggesting diverse subcellular distributions depending on cell type . When studying recombinant bovine RABAC1, researchers should expect similar localization patterns, though species-specific variations may occur.

What are the primary molecular interactions of RABAC1?

RABAC1 engages in several critical protein-protein interactions:

  • Rab GTPase binding: RABAC1 directly binds to Rab GTPases (such as Rab3A) in their prenylated form, which is essential for proper vesicular trafficking .

  • SNARE protein interaction: RABAC1 interacts with vesicle-associated membrane proteins, particularly VAMP2 (a v-SNARE) .

  • GDI interaction: RABAC1 binds to GDP dissociation inhibitor (GDI) and acts as a GDI dissociation factor to facilitate transfer of cytosolic GDP-bound Rab to membranes during vesicular trafficking .

  • BCL2A1 binding: RABAC1 interacts with the anti-apoptotic protein BCL2A1, inhibiting its function and potentially inducing apoptosis .

These interactions are typically verified using multiple complementary approaches such as glutathione-S-transferase (GST) pull-down assays, co-immunoprecipitation, and confocal microscopy .

How do point mutations in RABAC1 affect cellular function?

Point mutations in RABAC1 can dramatically alter its cellular localization and function. Based on extensive mutation studies, RABAC1 mutations can be categorized into three distinct classes with different phenotypic consequences:

Mutation ClassCellular LocalizationFunctional EffectsBinding Properties
Class A (e.g., N70T)Endoplasmic reticulum (ER) retentionInhibits transport of cargo from ER to Golgi and plasma membraneSignificant decrease in both Rab3A and VAMP2 binding
Class B (e.g., S76A)Highly condensed Golgi complexInhibits exit of anterograde cargo from Golgi3-fold increase in Rab3A binding; 6-fold increase in VAMP2 binding
Class C (e.g., H166A)Intermediate phenotype (Golgi and ER localization with tubular structures)Partial inhibition of vesicular transportReduced binding to Rab3A and VAMP2

These mutations reveal that RABAC1's ability to interact with Rab GTPases and SNARE proteins directly correlates with its effects on vesicular trafficking . When designing recombinant bovine RABAC1 constructs, researchers should consider these mutation effects to create useful experimental tools or to investigate specific aspects of RABAC1 function.

What methodologies are most effective for analyzing RABAC1 mutations?

When studying RABAC1 mutations, a multi-faceted approach yields the most comprehensive insights:

  • Protein-protein interaction assays: Yeast two-hybrid screening provides initial assessment of binding capabilities, while in vitro pull-down assays with purified recombinant proteins (His6-HA-tagged RABAC1, GST-VAMP2, His6-tagged Rab3A) offer quantitative measurement of binding affinities .

  • Cellular localization analysis: Immunofluorescence microscopy with co-staining for organelle markers (such as GM130 for cis-Golgi) allows precise determination of mutant RABAC1 localization patterns .

  • Vesicular trafficking assays: Monitoring transport of reporter proteins like VSVG ts045-GFP provides functional readouts of trafficking defects caused by RABAC1 mutations .

  • Biochemical fractionation: Membrane fractionation followed by Western blotting helps determine the subcellular distribution of mutant RABAC1 proteins .

  • Structural analysis: Mapping mutations onto predicted structural models helps correlate functional effects with specific protein domains.

What is the mechanistic role of RABAC1 in Golgi vesicle formation?

RABAC1 serves as a critical component in vesicle formation at the Golgi complex through several coordinated mechanisms:

  • Rab GTPase recruitment: RABAC1 facilitates the transfer of GDP-bound Rab proteins from the cytosol to Golgi membranes by acting as a GDI dissociation factor, promoting the association of Rab proteins with specific membrane domains .

  • SNARE protein coordination: By binding to v-SNAREs like VAMP2, RABAC1 helps ensure proper incorporation of fusion machinery into budding vesicles .

  • Cargo sequestration: RABAC1 may influence the recruitment of Rab effectors during cargo selection and sequestration in forming vesicles .

  • Oligomerization-dependent function: RABAC1's ability to form at least dimers suggests it may help create specialized membrane domains that recruit multiple components of trafficking machinery simultaneously .

Disruption of RABAC1 function through mutations or depletion leads to condensed Golgi morphology similar to that observed with dominant-negative dynamin 2 expression, which blocks vesicle formation from the trans-Golgi network . This indicates RABAC1's essential role in promoting vesicle budding rather than just participating in downstream vesicle targeting or fusion events.

How does RABAC1 coordinate with the Rab cycle during membrane trafficking?

RABAC1 coordinates with the Rab GTPase cycle at multiple points:

  • Membrane recruitment: RABAC1 acts as a GDI dissociation factor that facilitates the transfer of cytosolic GDP-bound Rab proteins to appropriate membranes by promoting the release of Rab from the Rab-GDI complex .

  • Spatial organization: Through its localization to Golgi and post-Golgi compartments, RABAC1 helps define the membrane domains where specific Rab proteins will function .

  • Effector recruitment: RABAC1 may influence the recruitment of Rab effectors that are necessary for subsequent vesicle docking and fusion events .

  • SNARE coordination: By simultaneously binding to Rab proteins and SNARE proteins like VAMP2, RABAC1 might couple the Rab cycle with SNARE complex formation, ensuring that vesicles contain all components necessary for subsequent fusion events .

Experimental approaches to study this coordination include live cell imaging with fluorescently tagged Rab proteins and RABAC1, in vitro reconstitution of Rab membrane association using purified components, and proteomics analysis of RABAC1-associated protein complexes.

What is the mechanism by which RABAC1 regulates BCL2A1-mediated apoptosis?

RABAC1 has been identified as an inhibitor of the anti-apoptotic protein BCL2A1, promoting apoptotic signaling in cancer cells through several mechanisms:

  • Direct protein interaction: RABAC1 physically interacts with BCL2A1, as demonstrated by glutathione-S-transferase pull-down assays, immunoprecipitation, and confocal microscopy .

  • Inhibition of anti-apoptotic activity: When apoptosis is induced by agents such as cisplatin, RABAC1 expression blocks the anti-apoptotic activity of BCL2A1, rendering cells more susceptible to apoptotic stimuli .

  • Caspase activation: RABAC1 promotes caspase-3 activation, a crucial step in the execution phase of apoptosis .

  • Anti-tumorigenic effects: RABAC1 expression decreases cell proliferation, clonogenic cell survival, and cell migration and invasion in AGS gastric cancer cells, suggesting broader anti-cancer effects beyond simple apoptosis regulation .

These findings position RABAC1 as a potential therapeutic target for cancers that rely on BCL2A1 overexpression for survival and drug resistance. Recombinant bovine RABAC1 could potentially be utilized as a research tool to explore these interactions in various experimental systems.

What experimental approaches are most suitable for studying RABAC1's role in apoptosis?

To investigate RABAC1's apoptotic functions, researchers should consider the following methodological approaches:

  • Protein interaction studies:

    • In vitro pull-down assays with purified recombinant proteins

    • Co-immunoprecipitation from cell lysates

    • Proximity ligation assays to detect interactions in situ

    • FRET/BRET assays for dynamic interaction studies

  • Apoptosis assays:

    • Caspase-3 activation measurement using fluorogenic substrates

    • Annexin V/PI staining and flow cytometry

    • TUNEL assays for DNA fragmentation

    • Mitochondrial membrane potential assessment

  • Cell viability and function:

    • Colony formation assays

    • Cell migration and invasion assays

    • Cell cycle analysis

    • Long-term growth curves with RABAC1 overexpression or knockdown

  • Cancer model systems:

    • Cell lines with differential BCL2A1 expression

    • Patient-derived xenografts

    • Combination studies with established chemotherapeutic agents

When using recombinant bovine RABAC1 for these studies, researchers should include appropriate controls to account for species-specific differences in protein-protein interactions.

How does RABAC1 expression and localization vary during retinal development?

RABAC1 shows distinct developmental and cell-type specific expression patterns in the retina:

  • Wild-type retinal expression: In wild-type mouse retinas at all developmental stages, RABAC1-like immunoreactivity (RABAC1-LIR) is consistently associated with Golgi and perinuclear regions of most inner retinal cells, with punctate labeling throughout both plexiform layers .

  • Photoreceptor-specific localization: At postnatal day 21 (P21), intense RABAC1-LIR is observed in photoreceptor inner segments (where Golgi membranes reside) and outer segments, with no staining in the outer nuclear layer (ONL) .

  • Developmental dynamics: In P10 wild-type retina, intense RABAC1-LIR is found in developing inner segments with Golgi neatly aligned at the inner segment margin, along with some RABAC1-LIR in the ONL associated with Golgi .

  • Differential expression in disease models: In the rd1 mouse model of retinal degeneration, RABAC1 was found to be differentially localized compared to wild-type retinas, and was the only identified gene (other than the mutant PDE6b) to be downregulated at all time points from P2-P8 .

These findings suggest that RABAC1 plays important roles in vesicular trafficking during retinal development, potentially contributing to the pathology of retinal degeneration when its expression or localization is disrupted.

What techniques are most effective for analyzing tissue-specific RABAC1 expression?

To effectively analyze tissue-specific RABAC1 expression and function, researchers should consider:

  • Immunohistochemistry and confocal microscopy:

    • Double-labeling with organelle markers (e.g., GM130 for cis-Golgi)

    • High-resolution imaging to detect subcellular localization patterns

    • Z-stack analysis for three-dimensional distribution

  • Transcriptional analysis:

    • Quantitative RT-PCR for tissue-specific expression levels

    • RNA-seq for comprehensive transcriptome analysis

    • In situ hybridization for spatial distribution of RABAC1 mRNA

  • Developmental studies:

    • Time-course analysis across key developmental stages

    • Comparison between normal and disease models

    • Correlation with expression of known developmental markers

  • Functional assays:

    • Tissue-specific knockdown or overexpression

    • Ex vivo tissue culture systems

    • Organoid models for developmental studies

When studying bovine RABAC1 specifically, researchers should consider species-specific antibodies or probes and account for potential cross-reactivity issues.

What expression systems yield optimal functional recombinant bovine RABAC1?

Production of functional recombinant bovine RABAC1 requires careful consideration of expression systems that preserve its native properties:

  • Bacterial expression systems:

    • E. coli BL21(DE3) can be used for high-yield production, typically with fusion tags (His6, GST, MBP) to enhance solubility

    • Expression as a fusion with His6-HA tags has been successfully employed for subsequent interaction studies

    • Codon optimization for bovine sequences may improve expression levels

    • Note that bacterial systems lack post-translational modifications that may be important for some RABAC1 functions

  • Eukaryotic expression systems:

    • Yeast systems (S. cerevisiae, P. pastoris) are advantageous when studying interactions with prenylated Rab proteins, as yeast can perform this modification

    • Insect cell systems (Sf9, High Five) offer higher eukaryotic processing with scalable production

    • Mammalian expression in HEK293 or CHO cells provides the most native-like post-translational modifications but at lower yields

  • Cell-free expression systems:

    • Useful for rapid screening of constructs and mutations

    • Can be coupled with microsomal membranes to study membrane integration

The choice of expression system should be guided by the intended application, with bacterial systems suitable for basic binding studies and structural analyses, while eukaryotic systems are preferable when studying interactions with prenylated Rab proteins or for functional assays that depend on post-translational modifications.

What purification and validation methods ensure high-quality recombinant RABAC1?

To obtain high-quality recombinant bovine RABAC1 suitable for research applications:

  • Purification strategies:

    • Affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) for His-tagged RABAC1

    • Glutathione-Sepharose for GST-fusion proteins

    • Size exclusion chromatography to remove aggregates and ensure homogeneity

    • Ion exchange chromatography as a polishing step

    • Consider detergent solubilization (mild non-ionic detergents) given RABAC1's membrane association

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Mass spectrometry for accurate mass determination and identification of post-translational modifications

    • Dynamic light scattering to assess homogeneity and detect aggregation

    • Circular dichroism spectroscopy to evaluate secondary structure integrity

  • Functional validation methods:

    • In vitro binding assays with known partners (Rab3A, VAMP2)

    • GDI dissociation activity assays to confirm functional activity

    • Liposome binding assays to assess membrane interaction capabilities

    • Thermal shift assays to evaluate protein stability

  • Storage considerations:

    • Test protein stability in various buffer conditions

    • Evaluate freeze-thaw stability

    • Consider lyophilization for long-term storage if the protein remains stable

For studies involving interactions with prenylated Rab proteins, it is particularly important to verify that recombinant Rab proteins used in the assays have the appropriate prenyl modifications, as these are essential for RABAC1 binding .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.