Recombinant Bovine Probable G-protein coupled receptor 171 (GPR171)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Probable G-Protein Coupled Receptor 171 (GPR171)

Recombinant Bovine Probable G-Protein Coupled Receptor 171 (GPR171) is a synthetic protein engineered for research and therapeutic applications. This recombinant protein corresponds to the full-length sequence of bovine GPR171, expressed in E. coli and tagged with an N-terminal His-tag for purification and detection. Below is a structured analysis of its technical specifications, biological roles, and research implications.

Product Overview

ParameterDetails
Catalog NumberRFL18779BF
SpeciesBovine
SourceE. coli expression system
TagN-terminal His-tag
Protein LengthFull-length (1-319 amino acids)
Molecular Weight~35 kDa (estimated based on sequence)
FormLyophilized powder
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

Role in Immune Regulation

GPR171 functions as a T-cell checkpoint receptor, modulating immune responses:

  • T-Cell Suppression: Binding of its ligand, BigLEN, inhibits T-cell receptor (TCR) signaling, reducing proliferation and cytokine production .

  • Cancer Immunotherapy: Blocking GPR171 enhances antitumor immunity by promoting T-cell activation and improving checkpoint inhibitor efficacy (e.g., PD-1/PD-L1 inhibitors) .

ApplicationMechanismOutcome
Antitumor TherapyGPR171 antagonist administration in tumor-bearing miceEnhanced T-cell infiltration in tumors
T-Cell Anergy ModelPeptide-induced anergy with GPR171 antagonistIncreased T-cell survival and expansion

Role in Cancer Progression

GPR171 overexpression correlates with aggressive lung cancer phenotypes:

  • Proliferation: Depletion of GPR171 via siRNA or antibody treatment reduces lung cancer cell growth in vitro and in vivo .

  • Metastasis: GPR171 knockdown inhibits migration and invasion of lung cancer cells (e.g., A549 and Calu-6 lines) .

Cancer TypeGPR171 ExpressionFunctional Impact
Lung CarcinomaOverexpressed in 46.8% casesPromotes tumor growth and metastasis
Xenograft ModelsAnti-GPR171 antibodyTumor volume reduction by 50%

Role in Metabolic Regulation

GPR171 interacts with the neuropeptide BigLEN to regulate feeding behavior and energy balance:

  • Hypothalamic Signaling: GPR171 activation in the hypothalamus suppresses food intake, linking it to obesity and metabolic disorders .

  • Therapeutic Potential: Targeting GPR171 may offer dual benefits for cancer and metabolic diseases .

Limitations in Current Studies

  • Ligand Specificity: While BigLEN is identified as a GPR171 ligand, other potential ligands remain uncharacterized .

  • Structural Insights: No crystal structures of GPR171 or its ligand-receptor complexes are available, limiting drug design .

Emerging Research Opportunities

  • Dual-Target Therapies: Combining GPR171 inhibitors with EGFR inhibitors shows synergistic effects in lung cancer models .

  • Biomarker Development: GPR171 expression levels in tumors may predict therapeutic responses to immunotherapy .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, kindly indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR171; Probable G-protein coupled receptor 171
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MTNSSTFCPVYRDLEPFTYFFYLVFLIGIIGSCFATWAFIQKNTNHRCVSIYLINLLTAD FLLTLALPVKITVDLGVAPWKLRIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTYSC KIYRIQEPGFAKMISAVVWLMVLLIMVPNMIIPIKDIKEKPNVGCMEFKSEFGRNWHLLT NFISIAIFFNFSAIILISNCLVIRQLYRNKDNENYPNVKRALISILLVTTGYIICFVPYH IVRIPYTLSQTEVISDCSTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRLKITETF ASHKESKAQKEKPRSENNA
Uniprot No.

Target Background

Function
Orphan receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of bovine GPR171?

Bovine Probable G-protein Coupled Receptor 171 (GPR171) is a seven-transmembrane protein consisting of 319 amino acids with a molecular weight of approximately 36 kDa. The full-length protein sequence begins with MTNSSTFCP and continues through to the C-terminal KPRSENNA . GPR171 belongs to the Class A (rhodopsin-like) family of G protein-coupled receptors (GPCRs), which are characterized by their seven alpha-helical transmembrane domains connected by alternating intracellular and extracellular loops. The protein features multiple domains critical for ligand binding and signal transduction, with conserved motifs typical of the GPCR superfamily. The extracellular N-terminus contains potential glycosylation sites, while the intracellular C-terminus contains residues involved in G protein coupling and downstream signaling events.

What is the endogenous ligand for GPR171 and how does it function?

The endogenous ligand for GPR171 is BigLEN, a neuropeptide derived from ProSAAS, which is one of the most abundant proteins in the brain . ProSAAS undergoes post-translational processing to generate several bioactive peptides, including BigLEN. When BigLEN binds to GPR171, it triggers a conformational change in the receptor that activates associated G proteins, initiating downstream signaling cascades. This signaling pathway has been implicated in pain modulation, particularly in the ventrolateral periaqueductal gray region. Importantly, ProSAAS distribution in the brain does not always match GPR171 distribution; for instance, in the ventral tegmental area (VTA), GPR171 is primarily localized in dopamine neurons while ProSAAS is found outside these neurons . This differential distribution suggests complex paracrine signaling mechanisms that may be important for understanding the physiological role of this receptor-ligand system.

What are the key differences between bovine GPR171 and human GPR171?

While bovine GPR171 and human GPR171 share significant sequence homology (approximately 85-90% identity), there are several key differences that researchers should consider when designing experiments. The sequence variations primarily occur in the N-terminal region and the third intracellular loop, which may impact ligand binding specificity and G protein coupling, respectively. Despite these differences, the core transmembrane domains remain highly conserved, suggesting preservation of fundamental signaling mechanisms across species. The UniProt ID for bovine GPR171 is Q3ZBK9 , while the human ortholog has a different identifier. These differences necessitate careful consideration when translating findings from bovine models to human applications, particularly when developing therapeutic compounds targeting the receptor. Sequence alignment studies have helped identify conserved residues that may represent critical functional domains for ligand binding or signal transduction.

What are the optimal conditions for expressing recombinant bovine GPR171?

The optimal expression system for recombinant bovine GPR171 depends on the specific experimental requirements. For high-yield production of functional protein, Escherichia coli (E. coli) has been successfully employed as demonstrated by the commercially available recombinant full-length bovine GPR171 protein fused to an N-terminal His tag . For expression in E. coli, the use of specialized strains like BL21(DE3) with appropriate vector systems has proven effective for other GPCRs . The expression conditions typically involve induction with IPTG at lower temperatures (16-20°C) to minimize inclusion body formation and promote proper folding. Alternative expression systems include yeast (Pichia pastoris SMD1163), which has been successful for other GPCRs such as the H₁ receptor and A₂A receptor , and insect cell systems (Sf9) that provide a eukaryotic environment conducive to proper protein folding and post-translational modifications.

What purification strategy yields the highest purity of functional GPR171?

A multi-step purification strategy is essential for obtaining high-purity functional GPR171. Initially, affinity chromatography using Ni-NTA resin can effectively capture the His-tagged protein . This should be followed by size exclusion chromatography to separate monomeric receptor from aggregates and other impurities. Throughout the purification process, maintaining the protein in a stabilizing detergent environment is critical; commonly used detergents include n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG). The purified protein can be verified by SDS-PAGE, with purity levels exceeding 90% being achievable . For functional studies, it's advisable to confirm receptor activity through ligand binding assays using known ligands such as BigLEN or synthetic compounds like MS15203. Western blotting with GPR171-specific antibodies provides additional validation of identity and integrity.

How can isotopically labeled GPR171 be prepared for NMR studies?

Preparation of isotopically labeled GPR171 for NMR studies represents one of the most challenging aspects of GPCR research due to difficulties in expression and long-term stability issues . The most effective approach involves expression in E. coli grown in minimal media supplemented with ¹⁵N-labeled ammonium chloride and/or ¹³C-labeled glucose as the sole nitrogen and carbon sources, respectively. For deuteration, D₂O-based media can be employed. The expression protocol typically requires optimization of growth temperature, induction timing, and inducer concentration to balance protein yield with proper folding. Given the challenges in preparing isotopically labeled GPCRs, alternative strategies include selective labeling of specific residues or domains, or the use of cell-free expression systems that allow for more efficient incorporation of labeled amino acids. Post-purification, the protein must be reconstituted in an NMR-compatible membrane mimetic environment such as nanodiscs or bicelles to maintain native-like structure and function.

What techniques are most effective for structural characterization of GPR171?

For comprehensive structural characterization of GPR171, a multi-faceted approach is necessary. X-ray crystallography remains the gold standard for high-resolution structure determination of GPCRs , though it requires significant protein engineering to enhance thermostability and crystallizability, potentially through techniques such as fusion protein construction or introduction of stabilizing mutations. Cryo-electron microscopy (cryo-EM) has emerged as a powerful alternative, particularly for capturing GPR171 in complex with various signaling partners. For dynamic information, NMR spectroscopy provides valuable insights into conformational changes during activation, though it faces challenges due to difficulties in preparing isotopically labeled receptors and their low long-term stabilities . Complementary approaches include hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map ligand-binding interfaces and conformational changes, and molecular dynamics simulations to predict structural dynamics based on homology models of GPR171 derived from related GPCRs with known structures.

How does ligand binding affect the conformational dynamics of GPR171?

Ligand binding to GPR171 induces specific conformational changes that propagate through the transmembrane helices to alter the arrangement of intracellular domains critical for G protein coupling. This conformational rearrangement follows the general mechanism observed in other Class A GPCRs, where ligand binding causes an outward movement of transmembrane helix 6, creating a binding pocket for G protein interaction. The specific small molecule agonist MS15203 has been shown to activate GPR171 signaling pathways involved in pain modulation , suggesting it stabilizes an active receptor conformation. Interestingly, unlike many other GPCR agonists, MS15203 does not appear to significantly activate ventral tegmental area neurons or induce reward behavior, as demonstrated by c-Fos staining and conditioned place preference experiments . This unique pharmacological profile indicates that MS15203 may induce a biased signaling state of GPR171 that selectively activates pain modulatory pathways without engaging reward circuitry, highlighting the complex relationship between conformational dynamics and downstream signaling outcomes.

What signaling pathways are activated downstream of GPR171?

GPR171 activation triggers multiple intracellular signaling cascades with tissue-specific outcomes. Primary signaling occurs through G protein-dependent pathways, with GPR171 coupling predominantly to inhibitory G proteins (Gαi/o), leading to inhibition of adenylyl cyclase and reduction in cAMP levels. This signaling pathway contributes to the pain-modulatory effects observed in the ventrolateral periaqueductal gray region . Secondary signaling mechanisms may include β-arrestin recruitment, which can lead to receptor internalization and desensitization, as well as activation of alternative signaling pathways independent of G proteins. The distribution of GPR171 in various brain regions, including the hippocampus, basolateral amygdala, nucleus accumbens, prefrontal cortex, and ventral tegmental area , suggests involvement in diverse neural processes beyond pain modulation. Notably, the absence of significant c-Fos activation in the ventral tegmental area following MS15203 administration indicates that GPR171 activation does not strongly engage dopaminergic reward pathways under these conditions .

How does GPR171 contribute to pain modulation mechanisms?

GPR171 plays a significant role in pain modulation through its expression in key neuroanatomical regions involved in nociceptive processing, particularly the ventrolateral periaqueductal gray . This structure is essential for both endogenous pain control and the analgesic effects of opioids. When activated by either endogenous ligands like BigLEN or synthetic agonists such as MS15203, GPR171 modulates neuronal activity in pain circuits through inhibitory G protein signaling pathways. Research has demonstrated that the GPR171 agonist MS15203 enhances morphine-mediated antinociception, suggesting a synergistic interaction between opioid and GPR171 signaling systems . This synergy potentially allows for lower dosages of opioid medications when co-administered with GPR171 agonists, which could reduce opioid-related side effects. Additionally, MS15203 has shown efficacy in reducing both inflammatory and neuropathic pain in male mice models, though interestingly these effects appear to be sex-specific with reduced efficacy in female mice .

What is the preclinical evidence for targeting GPR171 in pain management?

Extensive preclinical evidence supports GPR171 as a promising target for pain management. Studies have demonstrated that MS15203, a small molecule agonist for GPR171, effectively attenuates multiple pain modalities, including nociceptor-mediated acute pain, inflammatory pain, and chronic constriction injury neuropathic pain . In models of inflammatory pain, MS15203 administration resulted in significant reductions in mechanical allodynia and thermal hyperalgesia. For neuropathic pain conditions, such as paclitaxel-induced peripheral neuropathy, GPR171 activation provided substantial relief, though with notable sex differences in efficacy . Importantly for potential clinical applications, MS15203 enhances morphine antinociception, suggesting that combination therapy could allow for reduced opioid dosing . Perhaps most significantly for addiction liability concerns, conditioned place preference experiments demonstrated that, unlike morphine, MS15203 does not produce reward-related behavior, as evidenced by the lack of place preference compared to saline controls . This favorable profile suggests that GPR171 agonists might offer analgesic benefits without the reward-related properties that contribute to opioid addiction.

What methods are used to evaluate GPR171-targeting compounds for analgesia and side effects?

Evaluation of GPR171-targeting compounds involves a comprehensive battery of tests assessing both therapeutic efficacy and potential side effects. For analgesic efficacy, researchers employ models of acute pain (hot plate test, tail-flick assay), inflammatory pain (complete Freund's adjuvant or carrageenan injection), and neuropathic pain (chronic constriction injury, paclitaxel-induced neuropathy) . These assays measure behavioral responses such as withdrawal latencies, mechanical thresholds using von Frey filaments, and thermal sensitivity via radiant heat. To assess potential reward liability and abuse potential, conditioned place preference paradigms are utilized, where animals are conditioned to associate drug effects with specific environmental contexts . The experimental design typically involves distinct chambers with different visual, tactile, and olfactory cues, with treatment administered on alternating days in designated chambers over a conditioning period of 8-10 days. For mechanistic insights, ex vivo electrophysiology in brain slices and immunohistochemical detection of activation markers like c-Fos provide valuable information about neural circuit engagement . Additional safety assessments include monitoring for respiratory depression, locomotor effects, and gastrointestinal function to create a comprehensive profile of the compound's effects.

What are the recommended storage and handling procedures for recombinant GPR171?

Optimal storage and handling of recombinant bovine GPR171 protein requires specific conditions to maintain stability and functionality. The lyophilized powder form should be stored at -20°C to -80°C upon receipt . For working solutions, aliquoting is essential to avoid repeated freeze-thaw cycles, which can significantly compromise protein integrity . Reconstitution should be performed in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL, and the addition of glycerol to a final concentration of 5-50% (with 50% being optimal) is recommended for long-term storage at -20°C to -80°C . For short-term use, working aliquots can be maintained at 4°C for up to one week . Prior to opening, vials should be briefly centrifuged to ensure all material is at the bottom of the container. The storage buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0) has been optimized to enhance stability . For functional studies requiring membrane insertion, additional steps involving detergent solubilization and reconstitution into lipid bilayers or nanodiscs may be necessary to maintain the native conformation of this seven-transmembrane protein.

How can researchers design effective ligand binding assays for GPR171?

Designing effective ligand binding assays for GPR171 requires careful consideration of multiple factors to ensure reliable and reproducible results. Radioligand binding assays using tritiated ([³H]) or iodinated ([¹²⁵I]) versions of known ligands such as BigLEN or MS15203 can provide quantitative information about binding affinities and receptor density. Alternatively, fluorescence-based approaches using fluorescently labeled ligands combined with fluorescence polarization or FRET techniques offer non-radioactive methods for measuring binding interactions. Competition binding assays, where unlabeled test compounds compete with labeled reference ligands, are particularly useful for screening potential new GPR171 modulators. The assay buffer composition is critical, typically requiring physiological pH (7.4), appropriate salt concentration, and the inclusion of protease inhibitors to prevent receptor degradation. For membrane-bound GPR171, addition of GTP or its non-hydrolyzable analogs can help distinguish between high and low-affinity binding states. Data analysis should include appropriate curve fitting to determine binding parameters such as Kd (dissociation constant) and Bmax (maximum binding capacity) for saturation experiments, or Ki (inhibition constant) for competition experiments.

What cell-based assays are most informative for studying GPR171 function?

Cell-based assays provide crucial information about GPR171 functionality and pharmacology in a more physiologically relevant context than protein-only systems. Since GPR171 couples predominantly to Gαi/o proteins, assays measuring inhibition of forskolin-stimulated cAMP production using ELISA, radioimmunoassay, or luminescence-based reporters (e.g., GloSensor, BRET-based sensors) are particularly informative. Additional second messenger assays may include measurement of intracellular calcium mobilization using fluorescent calcium indicators, or assessment of extracellular signal-regulated kinase (ERK) phosphorylation via western blotting or ELISA. For investigating β-arrestin recruitment, bioluminescence resonance energy transfer (BRET) or enzyme complementation assays provide real-time monitoring of this interaction. Cell-based receptor internalization assays using fluorescently tagged GPR171 can reveal ligand-induced trafficking dynamics. When designing these experiments, careful selection of the cellular background is essential; endogenous expression of GPR171 or related receptors in the chosen cell line should be considered, as should the complement of G proteins and other signaling components. Heterologous expression systems commonly used include HEK293, CHO, and COS-7 cells, each with specific advantages for particular assay types.

How can researchers investigate the role of GPR171 in different neuroanatomical regions?

Investigating GPR171 function across different neuroanatomical regions requires a combination of molecular, cellular, and systems neuroscience approaches. Region-specific expression analysis using RNAscope in situ hybridization or immunohistochemistry with validated antibodies provides the foundation for understanding GPR171 distribution patterns. The brain regions of particular interest include the hippocampus, basolateral amygdala, nucleus accumbens, prefrontal cortex, and ventral tegmental area, all of which show GPR171 expression . For functional studies, Cre-dependent viral vectors can be used to achieve region-specific manipulation of GPR171 expression in transgenic mouse lines. Electrophysiological recordings in acute brain slices following application of GPR171 ligands can reveal region-specific effects on neuronal excitability, synaptic transmission, and plasticity. More advanced techniques include in vivo fiber photometry or miniaturized microscopy to monitor neural activity in GPR171-expressing populations during behavior. For circuit-level analysis, optogenetic or chemogenetic approaches can be combined with GPR171 pharmacology to dissect the interaction between specific neural pathways and GPR171 signaling. These multi-level approaches are essential for understanding how GPR171 modulates complex behaviors like pain perception, which involves distributed neural networks.

What are the critical considerations for developing selective GPR171 ligands?

Development of highly selective GPR171 ligands represents a significant challenge due to the structural similarities between GPCRs and the limited structural information specific to GPR171. Rational drug design approaches should begin with homology modeling based on crystallized GPCRs with the highest sequence similarity to GPR171, followed by molecular docking studies to identify potential binding pockets. Structure-activity relationship (SAR) studies starting from known ligands like MS15203 can guide chemical modifications to improve selectivity, potency, and pharmacokinetic properties. Critical pharmacophore features that determine GPR171 binding specificity should be identified and preserved. Comprehensive selectivity screening against a panel of related GPCRs is essential, with particular attention to receptors expressed in similar anatomical regions. Lead compounds should be characterized using multiple functional assays to detect potential biased signaling, where a ligand preferentially activates specific downstream pathways over others. This property could be advantageous for developing analgesics with reduced side effects. Additionally, species differences in GPR171 structure may affect ligand binding, necessitating cross-species testing to ensure translatability from animal models to humans. Finally, medicinal chemistry optimization should address absorption, distribution, metabolism, excretion, and toxicity (ADMET) properties to enhance drug-like characteristics.

What approaches can elucidate the physiological role of the ProSAAS-BigLEN-GPR171 signaling axis?

Elucidating the physiological role of the ProSAAS-BigLEN-GPR171 signaling axis requires integrated approaches spanning molecular to behavioral levels of analysis. Genetic models, including conditional knockout mice for ProSAAS or GPR171, can reveal phenotypic consequences of disrupting this signaling pathway in specific tissues or developmental stages. Particularly informative would be cell-type-specific deletions in neuronal populations implicated in pain processing or reward. Microdialysis combined with mass spectrometry can measure dynamic changes in BigLEN levels in response to physiological stimuli or pathological conditions, providing insights into the endogenous regulation of this signaling system. Viral-mediated overexpression or knockdown of pathway components, combined with functional readouts such as pain sensitivity, stress responses, or reward behaviors, can establish causal relationships between signaling alterations and physiological outcomes. The distinct anatomical distribution patterns of ProSAAS and GPR171, particularly in regions like the ventral tegmental area where GPR171 is primarily in dopamine neurons while ProSAAS is located outside these neurons , suggests complex paracrine signaling mechanisms that could be investigated using cell-specific genetic tools and ex vivo electrophysiology. Additionally, examining the interaction between the ProSAAS-BigLEN-GPR171 axis and other neurotransmitter systems, particularly opioids given the established synergy between GPR171 agonists and morphine , would provide valuable insights into integrated neural signaling networks.

How should researchers analyze and interpret GPR171 binding data?

Analysis of GPR171 binding data requires robust statistical approaches and appropriate model selection to extract meaningful pharmacological parameters. For saturation binding experiments, data should be fitted to one-site or two-site binding models using non-linear regression to determine dissociation constant (Kd) and maximum binding capacity (Bmax) values. Competition binding data analysis typically employs the Cheng-Prusoff equation to convert IC50 values to Ki values, accounting for the concentration and Kd of the radioligand used. When analyzing binding kinetics, association and dissociation rate constants (kon and koff) can be determined through global fitting of time-course data. All binding parameters should be reported with appropriate statistical measures of uncertainty (standard error or 95% confidence intervals) and compared across experimental conditions using suitable statistical tests. Potential confounding factors to consider in data interpretation include non-specific binding, ligand depletion effects, and the impact of membrane composition on receptor conformation and binding properties. For GPR171 specifically, the potential influence of G protein coupling on ligand affinity (the so-called "high-affinity state") should be considered by conducting binding experiments in the presence and absence of guanine nucleotides, which can shift the receptor population between coupled and uncoupled states.

What statistical approaches are most appropriate for behavioral studies involving GPR171?

Behavioral studies investigating GPR171 function require careful statistical planning and analysis to account for the inherent variability in animal experiments. For pain-related behavioral assessments, such as withdrawal thresholds or latencies, repeated measures analysis of variance (ANOVA) is typically appropriate when tracking responses over time after drug administration. This approach should include appropriate post-hoc tests (e.g., Bonferroni, Tukey) for multiple comparisons. For conditioned place preference experiments, the time spent in drug-paired versus saline-paired compartments can be compared using paired t-tests within each treatment group, with between-group comparisons using one-way ANOVA . Sample size calculations should be performed a priori based on expected effect sizes from pilot studies or published literature to ensure adequate statistical power. The incorporation of both positive controls (e.g., morphine in analgesic studies) and negative controls is essential for validating experimental paradigms . Given the reported sex differences in GPR171-mediated effects, sex should be included as a biological variable in experimental design and analysis. Advanced statistical approaches such as mixed-effects models can be valuable for handling missing data points and accounting for both fixed effects (treatment, time, sex) and random effects (individual animal variability). Finally, transparent reporting of all statistical methods, including specific tests, exact p-values, and measures of effect size, is crucial for reproducibility.

What are the key challenges in translating GPR171 research from animal models to human applications?

Translating GPR171 research from preclinical models to human applications faces several significant challenges. Species differences in GPR171 sequence, expression patterns, and signaling mechanisms may limit the predictive value of animal studies. While bovine and human GPR171 share substantial homology, key differences in amino acid sequence could affect ligand binding properties and downstream signaling. The sex-specific effects observed in rodent pain models, where male mice show greater responses to GPR171 agonists than females , raise important questions about potential gender differences in humans that would need systematic investigation. Pharmacokinetic considerations, including blood-brain barrier penetration of GPR171-targeting compounds, metabolic stability, and potential off-target effects, require thorough characterization prior to human studies. The development of translational biomarkers to assess target engagement and efficacy in humans represents another challenge, potentially requiring the development of PET ligands or other non-invasive measures of GPR171 activity. Given the localization of GPR171 in reward-related brain regions, albeit with minimal reward liability indicated in preclinical studies , careful assessment of abuse potential in humans would be necessary through rigorous clinical trials designed to detect subtle reward-related effects not captured in animal models.

How might GPR171-targeting therapeutics complement existing pain management approaches?

GPR171-targeting therapeutics hold promise as complementary agents in multimodal pain management strategies. The demonstrated ability of MS15203 to enhance morphine antinociception suggests potential use as an adjuvant to allow opioid dose reduction while maintaining analgesic efficacy . This approach could help mitigate opioid-related adverse effects, including respiratory depression, constipation, and dependence liability. The efficacy of GPR171 agonists in both inflammatory and neuropathic pain models indicates broad analgesic potential applicable to diverse pain conditions . Unlike direct opioid receptor agonists, GPR171 activators have shown minimal reward liability in preclinical studies , suggesting they may offer reduced addiction risk compared to conventional opioids. For conditions like chemotherapy-induced peripheral neuropathy, where treatment options remain limited, GPR171 agonists could fill an important therapeutic gap. Integration into existing pain management protocols might involve combination with first-line agents such as gabapentinoids, antidepressants, or non-steroidal anti-inflammatory drugs, potentially allowing dose reductions of these medications as well. Beyond pharmacological approaches, exploration of how GPR171-mediated analgesia might be enhanced by non-pharmacological interventions such as physical therapy, cognitive behavioral therapy, or neuromodulation techniques represents an important direction for comprehensive pain management strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.