Recombinant Bovine Probable G-protein coupled receptor 52 (GPR52)

Shipped with Ice Packs
In Stock

Description

Constitutive Gs-Coupled Activity

GPR52 exhibits unusually high basal Gs signaling activity, achieving 83–87% of maximal cAMP production even in the absence of agonists. This is attributed to its extracellular loop 2 (ECL2), which acts as a built-in agonist by occupying the orthosteric binding pocket .

Therapeutic Implications

  • Neuropsychiatric Disorders: GPR52 agonism is proposed to modulate dopamine D1/D2 receptor pathways, making it a target for schizophrenia .

  • Huntington’s Disease: Inverse agonists (e.g., Cannabidiol, O-1918) reduce mutant Huntingtin protein levels, rescuing behavioral deficits in mouse models .

  • Immune Modulation: Despite regulating cAMP in T cells, GPR52 deletion does not alter T cell function or autoimmune disease progression in experimental models .

Comparative Analysis of GPR52 Constructs

FeaturePartial GPR52 (1–44)Full-Length GPR52 (1–361)
Use CasesLigand-binding studies, epitope mappingFull receptor signaling assays
Functional DataLimited to N-terminal interactionsCaptures ECL2-mediated self-activation
Glycosylation ImpactNot applicable (truncated)Critical for trafficking and signaling

Challenges and Future Directions

  • Ligand Development: No endogenous ligands are confirmed, though synthetic agonists (e.g., wo-459) and inverse agonists exist .

  • Species Specificity: Bovine GPR52 shares 70% homology with human GPR52, but functional differences remain unexplored .

  • Pathway Elucidation: Signaling mechanisms beyond cAMP (e.g., β-arrestin recruitment) are poorly characterized .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR52; G-protein coupled receptor 52
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MNDSRWTEWRILNTSSGILNVSERHSCPLGFGHYSAVDVCIFETIVIVLLTFLIIAGNLT VIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGIHESLTCQVFGYI ISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGW GKPGYHGDIFEWCATSWLTSAYFTGFIVCLLYAPAALVVCFTYFHIFKICRQHTKEINDR RARFPSHEAAASRDAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSF LTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDKEARDPKPRKRANSCS I
Uniprot No.

Target Background

Function
G-protein coupled receptor activated by antipsychotics reserpine leading to an increase in intracellular cAMP and its internalization. May play a role in locomotor activity through modulation of dopamine, NMDA and ADORA2A-induced locomotor activity. These behavioral changes are accompanied by modulation of the dopamine receptor signaling pathway in the striatum. Modulates HTT level via cAMP-dependent but PKA independent mechanisms through activation of RAB39B that translocates HTT to the endoplasmic reticulum, thus avoiding proteasome degradation.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How conserved is GPR52 across mammalian species?

GPR52 demonstrates significant conservation across vertebrate species, suggesting its evolutionary importance in fundamental biological processes. Comparative analysis of bovine and mouse GPR52 sequences reveals high homology, with key functional domains being particularly well conserved .

When comparing bovine (UniProt ID: A6QLE7) and mouse (UniProt ID: P0C5J4) GPR52 proteins:

This conservation extends to human GPR52, suggesting that findings from bovine or mouse models may have translational relevance to human physiology and pathology .

What is known about GPR52 signaling pathways?

GPR52 has been characterized as a Gs-coupled receptor, meaning it activates adenylyl cyclase upon stimulation, leading to increased intracellular cAMP levels. Recent research indicates that GPR52 exhibits constitutive activity (basal signaling in the absence of ligand stimulation) due to a self-activation phenomenon revealed through structural studies .

Key aspects of GPR52 signaling include:

  • Coupling primarily to Gs proteins that stimulate cAMP production

  • Potential modulation of dopaminergic and glutamatergic neurotransmission in neural circuits involved in cognitive function and emotion

  • Responsiveness to the antipsychotic drug reserpine, suggesting a role in psychiatric regulation

  • Possible downstream effects on protein kinase A (PKA) and CREB-dependent gene transcription

Understanding these signaling mechanisms provides critical insights for researchers designing functional assays or exploring GPR52 as a therapeutic target.

What strategies have proven effective for recombinant expression of GPR52?

Successful expression of recombinant GPR52 has been achieved primarily in E. coli systems using specific fusion partners and expression optimization strategies. Drawing from general GPCR expression approaches and specific GPR52 protocols, several methodologies have demonstrated efficacy:

  • N-terminal fusion with maltose-binding protein (MBP) facilitates inner membrane insertion and improves folding

  • Dual fusion strategy using MBP at the N-terminus and thioredoxin (TrxA) at the C-terminus enhances expression levels

  • Alternative fusion combinations such as N-terminal Mistic with C-terminal TarCF have shown success with other GPCRs and may be applicable to GPR52

  • His-tag addition facilitates purification while minimally impacting protein structure and function

For bovine GPR52 specifically, expression in E. coli with an N-terminal His-tag has yielded functional protein suitable for biochemical and structural studies. The protein is typically expressed as a full-length construct (1-361 amino acids) to maintain native conformation and functionality .

What unique structural features have been identified in GPR52 through recent studies?

Recent breakthrough structural studies have revealed several distinctive features of GPR52:

  • A complete structural landscape covering multiple functional states:

    • Ligand-free (apo) state

    • Ligand-bound state

    • G protein-coupled state

  • A self-activation phenomenon not previously observed in other GPCRs, providing insights into its constitutive activity

  • Unique conformational changes during transition between inactive and active states, particularly in the transmembrane helices and intracellular loops

  • Specific ligand recognition mechanisms that may facilitate the development of selective modulators

These structural insights provide critical information for rational drug design and understanding the molecular basis of GPR52 function in both normal and pathological conditions.

How does the recombinant bovine GPR52 compare functionally to the native receptor?

Evaluating functional equivalence between recombinant and native GPR52 is critical for research validity. Several approaches can assess this correspondence:

  • Ligand binding assays comparing affinity constants (Kd) between recombinant and native receptors

  • G-protein coupling efficiency measurements through [35S]GTPγS binding assays

  • cAMP accumulation assays to verify Gs-coupling capacity

  • Structural integrity assessment through circular dichroism or limited proteolysis

Current evidence indicates that carefully produced recombinant bovine GPR52 with appropriate fusion partners retains key functional characteristics, including:

  • Correct folding of the seven-transmembrane domain structure

  • Ability to bind known ligands, including reserpine

  • Capacity to activate Gs-dependent signaling pathways

What are optimal conditions for expression and purification of recombinant bovine GPR52?

Based on established protocols for GPCR expression and specific information for GPR52, the following optimized conditions are recommended:

Expression:

  • Host: E. coli strain BL21(DE3) or equivalent

  • Expression vector: pET-based with T7 promoter

  • Fusion tags: N-terminal His-tag (minimal) or His-MBP (enhanced stability)

  • Induction: 0.5-1.0 mM IPTG at OD600 of 0.6-0.8

  • Post-induction temperature: 18-20°C for 16-20 hours

  • Media: Terrific Broth supplemented with glycerol

Purification:

  • Cell lysis: French press or sonication in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, protease inhibitors

  • Membrane extraction: Detergent solubilization (1% DDM or LMNG)

  • Primary purification: Ni-NTA affinity chromatography

  • Secondary purification: Size exclusion chromatography

  • Storage: Tris/PBS-based buffer with 6% trehalose at pH 8.0

For long-term stability, add 5-50% glycerol and store at -20°C/-80°C in small aliquots to avoid freeze-thaw cycles. Working aliquots may be stored at 4°C for up to one week .

What protein engineering strategies enhance GPR52 stability and crystallization properties?

Several protein engineering approaches have proven successful for improving GPCR stability and crystallization propensity, many of which can be applied to GPR52:

  • Terminal modifications:

    • Truncation of disordered N- and C-terminal regions that interfere with crystal contacts

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL, rubredoxin)

  • Loop engineering:

    • Replacement of the third intracellular loop (ICL3) with T4 lysozyme

    • Stability-enhancing mutations in extracellular loops

  • Thermostabilization:

    • Systematic alanine scanning to identify stabilizing mutations

    • Introduction of disulfide bridges to constrain flexible regions

    • Directed evolution approaches to select stable variants

  • Surface engineering:

    • Introduction of surface entropy reduction mutations

    • Addition of glycosylation sites to improve solubility

These approaches can be implemented individually or in combination to generate GPR52 constructs with improved biochemical properties for structural and functional studies.

What assays are recommended for validating the functional integrity of recombinant GPR52?

A comprehensive validation strategy should include:

  • Structural integrity assessment:

    • SDS-PAGE for size verification and purity (>90% purity is considered acceptable)

    • Circular dichroism for secondary structure analysis

    • Thermal stability assays (differential scanning fluorimetry)

  • Ligand binding capacity:

    • Radioligand binding assays using [3H]-labeled ligands

    • Fluorescence-based binding assays

    • Surface plasmon resonance for binding kinetics

  • Signaling competence:

    • cAMP accumulation assays to confirm Gs coupling

    • GTPγS binding assays for G protein activation

    • Bioluminescence resonance energy transfer (BRET) for protein-protein interaction studies

  • Pharmacological validation:

    • Dose-response curves for known ligands (e.g., reserpine)

    • Antagonist inhibition assays

    • Constitutive activity measurement

A functionally intact recombinant GPR52 should demonstrate appropriate pharmacological responses comparable to the native receptor, with proper dose-dependency and specificity.

What techniques have been successful in resolving the 3D structure of GPR52?

Recent breakthroughs in GPR52 structural determination have employed multiple complementary approaches:

  • X-ray crystallography:

    • Requires highly pure, homogeneous, and stable protein preparations

    • Often necessitates fusion with crystallization chaperones

    • Provides high-resolution static structures

  • Cryo-electron microscopy (cryo-EM):

    • Particularly valuable for capturing different functional states

    • Enables visualization of GPR52 in complex with G proteins

    • Requires less protein than crystallography

    • Increasingly achieves near-atomic resolution

  • Computational approaches:

    • Molecular dynamics simulations to study conformational dynamics

    • Homology modeling based on related GPCR structures

    • Integration with experimental data for model validation

The structural determination of GPR52 represents a significant achievement in the field of orphan GPCR research, providing insights into its functional mechanisms and potential for therapeutic targeting.

How does the structure of GPR52 change across different functional states?

The structural landscape of GPR52 reveals significant conformational changes across its functional states:

  • Ligand-free (apo) state:

    • Relatively closed ligand-binding pocket

    • Restricted movement of transmembrane helices

    • Inactive configuration of intracellular G protein-binding interface

  • Ligand-bound state:

    • Expansion of the orthosteric binding pocket

    • Outward movement of transmembrane helix 6

    • Reorganization of key residues in the binding pocket

  • G protein-coupled state:

    • Dramatic outward displacement of transmembrane helix 6

    • Formation of an intracellular cavity for G protein engagement

    • Stabilization of the active conformation by G protein interactions

These structural transitions provide crucial insights into the activation mechanism of GPR52 and offer potential targets for the development of therapeutic modulators with specific activity profiles.

What is the significance of the self-activation phenomenon observed in GPR52?

The recently discovered self-activation mechanism in GPR52 represents a novel finding with important implications:

  • It explains the constitutive activity observed in cellular assays

  • It provides a structural basis for developing inverse agonists that could modulate this basal activity

  • It suggests potential physiological roles in maintaining tonic signaling in neural circuits

  • It distinguishes GPR52 from many other GPCRs that require ligand binding for activation

This self-activation property may be particularly relevant in the context of GPR52's proposed role in psychiatric disorders, where abnormal constitutive signaling could contribute to pathological states.

What evidence supports GPR52 as a therapeutic target for neuropsychiatric disorders?

Multiple lines of evidence suggest GPR52 as a promising therapeutic target:

  • Expression pattern:

    • Enriched in brain regions implicated in psychiatric disorders

    • Co-expression with dopamine D2 receptors in specific neuronal populations

  • Genetic associations:

    • Genetic studies link GPR52 variants to neuropsychiatric conditions

    • Altered expression in post-mortem brain samples from psychiatric patients

  • Behavioral phenotypes:

    • GPR52 knockout mice exhibit psychosis-related behaviors

    • GPR52 transgenic mice show antipsychotic-like behaviors

    • These opposing phenotypes support GPR52's role in psychiatric regulation

  • Pharmacological modulation:

    • Responsiveness to the antipsychotic drug reserpine

    • Potential to modulate dopaminergic and glutamatergic neurotransmission

These findings collectively position GPR52 as a potential target for novel therapeutic approaches in psychiatric disorders, particularly those involving dopaminergic dysregulation.

How do transgenic and knockout GPR52 models inform our understanding of receptor function?

Genetic manipulation of GPR52 has generated valuable insights into its physiological roles:

  • GPR52 knockout models:

    • Exhibit psychosis-related behaviors, suggesting a role in mental stability

    • Show altered dopaminergic signaling in specific brain circuits

    • Provide a model for investigating mechanisms of psychotic disorders

  • GPR52 transgenic models:
    Three types of transgenic mice have been particularly informative:

    • GPR52-LacZ transgenic mice: Enable precise mapping of expression patterns

    • Human GPR52 transgenic mice: Display antipsychotic-like behaviors

    • hGPR52-GFP transgenic mice: Allow visualization of receptor localization and trafficking

  • Cre-lox systems under GPR52 promoter control:

    • Enable cell-specific manipulation of gene expression

    • Facilitate investigation of circuit-specific functions

    • Allow temporal control of GPR52 expression

These models provide complementary approaches to understanding GPR52 function in vivo and validate its potential as a therapeutic target.

What is known about the interaction between GPR52 and the antipsychotic drug reserpine?

Reserpine, an established antipsychotic compound, has been identified as a modulator of GPR52 function:

  • Binding characteristics:

    • Reserpine interacts with the orthosteric binding pocket of GPR52

    • The interaction involves specific residues within the transmembrane domains

    • The binding mode differs from reserpine's interaction with monoamine transporters

  • Functional effects:

    • Modulates GPR52's constitutive activity

    • Alters downstream cAMP signaling

    • May contribute to reserpine's complex antipsychotic profile

  • Structural insights:

    • Recent structural studies have begun to elucidate the molecular details of this interaction

    • These insights may guide the development of more selective GPR52 modulators

The interaction between GPR52 and reserpine provides a valuable starting point for medicinal chemistry efforts aimed at developing more selective and effective GPR52-targeted therapeutics.

What are the most promising approaches for developing selective GPR52 modulators?

Based on current knowledge, several strategies hold promise for developing selective GPR52-targeted compounds:

  • Structure-based drug design:

    • Utilizing the recently solved 3D structures to rationally design ligands

    • Virtual screening of compound libraries against the orthosteric binding pocket

    • Fragment-based approaches to identify high-efficiency binding modules

  • Allosteric modulation:

    • Targeting allosteric sites distinct from the orthosteric binding pocket

    • Developing positive or negative allosteric modulators to fine-tune receptor activity

    • Exploiting species differences to improve selectivity

  • Biased signaling approaches:

    • Designing ligands that selectively engage beneficial signaling pathways

    • Developing compounds that modulate the self-activation mechanism

    • Creating ligands that stabilize specific receptor conformations

These approaches could yield novel therapeutic agents with improved efficacy and reduced side effects compared to current psychiatric medications.

What methodological innovations might advance GPR52 research?

Several emerging technologies and methodological approaches could significantly accelerate GPR52 research:

  • Advanced structural methods:

    • Time-resolved crystallography to capture transition states

    • Cryo-EM of various ligand-receptor-effector complexes

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

  • Cellular and in vivo techniques:

    • CRISPR-based genome editing for precise genetic manipulation

    • Optogenetic and chemogenetic tools for temporal control of GPR52 activity

    • Advanced imaging techniques for tracking receptor dynamics in real-time

  • Computational approaches:

    • Machine learning for predicting ligand-receptor interactions

    • Long-timescale molecular dynamics simulations of activation mechanisms

    • Systems biology approaches to understand GPR52 in cellular networks

These methodological innovations promise to provide deeper insights into GPR52 biology and accelerate the development of therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.