Recombinant Bovine Probable glutathione peroxidase 8 (GPX8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can be used as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPX8; Probable glutathione peroxidase 8; GPx-8; GSHPx-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MEPLTAYPLRCSGPKAKAFAVLLSMVLCTVMLFLLQLKFLKPKINSFYTFEVKDANGRVV SLEKFKGKVALVVNVASDCQLTDRNYLALQELHKEFGPFHFSVLAFPCNQFGESEPRPSK EVVSFARNNFGVTFPIFHKIKILGSEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKT WRPEEPIEVIRPEIAALIRQMIIKKKEDL
Uniprot No.

Target Background

Database Links
Protein Families
Glutathione peroxidase family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What are the key biochemical functions of GPX8 compared to other glutathione peroxidases?

GPX8 demonstrates several distinct biochemical functions:

  • Glutathione peroxidase activity: Though GPX8 belongs to the GPx family, it shows relatively low glutathione peroxidase activity compared to selenocysteine-containing members like GPX1-4 .

  • Peroxidase activity: GPX8 can catalyze the reduction of peroxides, though with different substrate preferences than other family members .

The table below shows biochemical functions of GPX8 and related proteins:

FunctionRelated Proteins
Peroxidase activityPTGS1, GPX7, PTGS2B, IPCEF1, DUOX2, GPX1A, PRDX5, PRDX1, PTGS2, GPX4A
Glutathione peroxidase activityGPX1, PRDX6, MGST2, GSTK1, GPX4B, CLIC2, GPX4A, GSTT1, GPX5, GPX1A

Unlike classical GPXs that primarily function in antioxidant defense, GPX8 has been implicated in:

  • Protein disulfide isomerase (PDI) activity

  • Oxidative protein folding in the ER

  • Regulation of calcium homeostasis in the ER

  • Involvement in MAM (mitochondria-associated membranes) sites

What are the optimal conditions for expressing recombinant bovine GPX8 in E. coli systems?

For expressing recombinant bovine GPX8 in E. coli, researchers should consider the following methodological approach:

  • Expression System: Standard E. coli expression systems like BL21(DE3) are suitable hosts for GPX8 expression .

  • Vector Selection: pQE30 vectors with His-tag have been successfully used for GPX family protein expression, allowing for efficient purification .

  • Induction Conditions:

    • Temperature: Lower temperatures (16-25°C) often improve protein folding

    • IPTG concentration: 0.1-0.5 mM is typically sufficient

    • Duration: 4-16 hours, depending on expression levels and protein stability

  • Buffer Optimization: Tris/PBS-based buffers at pH 8.0 are recommended for stability .

  • Protein Tag Selection: An N-terminal His-tag is commonly used and does not significantly interfere with folding or activity .

For cysteine-containing GPX proteins like GPX8, attention to the redox environment during expression is crucial, as demonstrated in studies with other GPX family members .

What purification strategies yield the highest purity and activity of recombinant bovine GPX8?

A multi-step purification strategy for obtaining high-purity, active recombinant bovine GPX8:

  • Initial Capture: Ni-NTA affinity chromatography utilizing the His-tag

    • Loading buffer: Typically 50 mM sodium phosphate, 300 mM NaCl, pH 8.0

    • Washing: Incremental imidazole (10-40 mM) to remove non-specific binding

    • Elution: 250 mM imidazole in the same buffer

  • Buffer Exchange: Remove imidazole through dialysis or ultrafiltration against Tris/PBS-based buffer (pH 8.0)

  • Storage Considerations:

    • Add 6% trehalose as stabilizing agent

    • Aliquot and store at -20°C/-80°C

    • Add glycerol (final concentration 50%) for long-term storage

    • Avoid repeated freeze-thaw cycles

  • Quality Control:

    • Assess purity by SDS-PAGE (should be >90%)

    • Confirm identity by mass spectrometry

    • Analyze protein folding by circular dichroism

    • Verify activity through enzymatic assays

For reconstitution after lyophilization, researchers should reconstitute in deionized sterile water to 0.1-1.0 mg/mL concentration .

What are the optimal assay conditions for measuring bovine GPX8 enzymatic activity?

To accurately measure bovine GPX8 enzymatic activity, researchers should consider these methodological parameters:

  • Standard Peroxidase Assay Conditions:

    • Buffer: 0.1 M Tris/HCl with 5 mM EDTA (pH 7.6)

    • Temperature: 25°C

    • NADPH concentration: 240 μM

    • Substrate concentration: 100 μM H₂O₂ or appropriate hydroperoxide

    • Protein concentration: 0.13-2 μM GPX8

    • Total reaction volume: 150 μl

  • pH Optimization:

    • Optimal pH range: 7.0-8.0 (based on related GPX studies)

    • Buffer composition: 50 mM Tris/HCl, 50 mM Mes, 1 mM EDTA, 0.5 mg/ml BSA

  • Thiol Determination:

    • DTNB (5,5'-dithiobis-(2-nitrobenzoic acid)) method with ε₄₁₂ = 13.6 mM⁻¹·cm⁻¹

    • Reaction mixture: 200 μM DTNB and 10-100 μM thiol in 50 mM potassium phosphate (pH 8.0)

  • Monitoring Activity:

    • Spectrophotometric monitoring at 340 nm (NADPH oxidation)

    • Calculate activity based on NADPH consumption: ΔA₃₄₀/min

Unlike classical glutathione peroxidases, GPX8 has relatively lower activity and may require longer incubation times or higher enzyme concentrations for reliable measurements .

How can researchers effectively study GPX8 interaction with its physiological partners in experimental settings?

To study GPX8 interactions with physiological partners, researchers should employ these methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-GPX8 antibodies for pull-down experiments

    • Include appropriate controls (IgG control, negative control cell lines)

    • Analyze by western blot for interacting partners

  • Proximity Ligation Assay (PLA):

    • Particularly useful for studying GPX8 interactions with membrane proteins

    • Can detect protein-protein interactions in situ with subcellular resolution

    • Especially relevant for studying GPX8 in the ER membrane context

  • CRISPR/Cas9-mediated Knockout:

    • Generate GPX8 knockout cells to study functional relationships

    • Examine phenotypic changes in signaling pathways

    • Assess changes in expression of interacting proteins

  • Coexpression Analysis:
    Based on correlation studies, focus on these top interacting genes:

    Positively correlated genes:

    • COL1A2 (correlation: 0.845)

    • KDELR3 (correlation: 0.844)

    • SERPINH1 (correlation: 0.841)

    • TUBA1C (correlation: 0.834)

    • COL1A1 (correlation: 0.828)

    Negatively correlated genes:

    • JPH3 (correlation: -0.609)

    • REPS2 (correlation: -0.611)

    • ARPP21 (correlation: -0.614)

    • DUSP26 (correlation: -0.625)

    • ELFN2 (correlation: -0.643)

  • Pathway Analysis:

    • Focus on GPX8 interactions with proteins in glutathione metabolism pathways

    • Study relationship with ERO1-derived H₂O₂ and protein disulfide isomerase

    • Investigate calcium flux regulation mechanisms

How does GPX8 expression influence cancer progression and what experimental methods can be used to investigate this relationship?

GPX8 demonstrates significant associations with cancer progression across multiple studies:

What is the role of GPX8 in regulating oxidative stress in pathological conditions, and how can this be experimentally investigated?

GPX8's role in oxidative stress regulation in pathological conditions is multifaceted:

  • Mechanistic Role in Oxidative Stress:

    • Functions at the ER membrane to regulate ER-derived reactive oxygen species

    • May utilize ERO1-derived H₂O₂ during oxidative protein folding

    • Contributes to calcium homeostasis at MAM sites, influencing mitochondrial ROS production

  • Experimental Approaches:

    a) Oxidative Stress Measurements:

    • H₂O₂ fluorescent probes (e.g., DCFDA) to measure intracellular ROS levels

    • Glutathione assays to quantify GSH/GSSG ratios

    • Lipid peroxidation markers (MDA, 4-HNE) for oxidative damage

    b) ER Stress Analysis:

    • qPCR for ER stress markers (GRP78, CHOP, XBP1 splicing)

    • Western blotting for phosphorylated PERK and eIF2α

    • Calcium imaging to assess ER calcium dynamics

    c) Redox Proteomics:

    • Isotope-coded affinity tag labeling to identify redox-sensitive proteins

    • Mass spectrometry analysis of protein oxidation

    • Biotin-switch technique for detecting protein S-glutathionylation

  • Disease-Specific Investigations:

    • In cancer: Relationship between GPX8 expression and oxidative stress markers

    • In inflammatory conditions: Role in protecting against endoplasmic reticulum stress

    • During pregnancy: Contribution to redox regulation and oxidative stress

  • Genetic Manipulation Strategies:

    • CRISPR/Cas9 knockout to study consequences of GPX8 loss on cellular redox state

    • Site-directed mutagenesis of catalytic cysteine to examine enzyme-dependent effects

    • Conditional knockout models to study tissue-specific roles

How does GPX8 differ from selenocysteine-containing glutathione peroxidases in terms of catalytic mechanism and substrate specificity?

The catalytic mechanism and substrate specificity of GPX8 differ substantially from selenocysteine-containing glutathione peroxidases:

  • Catalytic Mechanism Differences:

    • Active Site Composition: GPX8 contains a cysteine residue instead of selenocysteine at the active site, which significantly affects reactivity

    • Reaction Kinetics: The redox potential of cysteine (E°' = -0.27V) is less favorable than selenocysteine (E°' = -0.38V), making GPX8 less reactive

    • Intermediate Formation: Unlike selenoenzymes that form selenenic acid (Se-OH), GPX8 forms sulfenic acid (S-OH) intermediates

  • Catalytic Residues:
    Studies with related cysteine-containing GPXs have identified critical catalytic residues:

    • The active site cysteine (corresponding to Cys47 in related enzymes)

    • A conserved glutamine residue (corresponding to Gln82 in related GPXs)

    • A second cysteine residue (corresponding to Cys95 in related GPXs)

    Mutagenesis studies show that replacing any of these residues abolishes peroxidase activity

  • Substrate Specificity:

    • GPX8 shows lower activity toward H₂O₂ compared to selenocysteine-containing GPXs

    • Unlike GPX4, which reduces complex lipid hydroperoxides efficiently, GPX8 has more limited substrate scope

    • GPX8 may have evolved specialized functions beyond classical peroxide reduction

  • Electron Donor Preference:

    • Selenoenzyme GPXs preferentially use GSH as electron donor

    • Cysteine-containing GPXs like GPX8 may utilize alternative electron donors

    • Some cysteine-containing homologs preferentially use thioredoxin rather than glutathione

  • Structural Basis for Catalytic Differences:

    • 3D modeling studies based on GPX1/GPX4 structures reveal distinct active site architectures

    • Critical distances between catalytic residues differ (e.g., 9.5Å distance between key cysteines in some models)

    • These structural differences explain the divergent reaction mechanisms and substrate preferences

What are the current hypotheses about GPX8's role in cellular signaling pathways, particularly in the context of the IL-6/STAT3 axis and cancer progression?

Current research indicates GPX8 plays significant roles in cellular signaling, particularly in cancer progression through several key pathways:

  • GPX8/IL-6/STAT3 Axis:

    • GPX8 has been identified as essential for maintaining IL-6 receptor functionality

    • In GPX8 knockout cells, the IL-6 receptor fails to properly interact with IL-6

    • This impaired binding hinders JAK/STAT3 signaling pathway activation

    • The pathway disruption inhibits cancer cells' transition to aggressive phenotypes

  • Mechanism of Action:

    • GPX8 loss suppresses aggressive phenotypes and stemness features in tumor cells

    • Mechanistically, these cells express a nonfunctional IL-6 receptor

    • The impaired IL-6 binding prevents downstream JAK/STAT3 signaling activation

    • This represents a novel metabolic-inflammatory pathway regulating cancer aggressiveness

  • BET Protein Regulation:

    • BRD2 and BRD4 (bromodomain proteins) were identified as transcriptional regulators of GPX8

    • siRNA-mediated knockdown of BRD2/BRD4 reduces GPX8 expression

    • BET inhibitor JQ1 downregulates GPX8 expression in multiple cell types

    • This regulation affects downstream migration ability and cytokine production

  • Cytokine Regulation Network:

    • GPX8 regulates secretion of key inflammatory mediators:

      • CCL2 production is reduced in GPX8-deficient conditions

      • IL-6 secretion is diminished when GPX8 is inhibited

    • These changes impact tumor microenvironment composition and function

  • Integration with Other Pathways:

    • GSEA analysis reveals GPX8 expression correlates with hedgehog and KRAS signaling (positive correlation)

    • Negative correlation with G2/M checkpoint, apoptosis, and ROS pathways

    • This pattern suggests GPX8 promotes cancer cell survival by modulating multiple critical pathways simultaneously

These mechanisms position GPX8 as a potential therapeutic target at the intersection of redox metabolism and inflammatory signaling in cancer.

What are the critical controls and experimental design considerations when studying GPX8 function in cellular systems?

When designing experiments to study GPX8 function, researchers should incorporate these methodological considerations:

  • Genetic Manipulation Controls:

    • Multiple knockout/knockdown clones: Use at least 2-3 independent clones to rule out off-target effects

    • Rescue experiments: Re-express GPX8 in knockout cells to confirm specificity of observed phenotypes

    • Scrambled controls: For siRNA/shRNA experiments, use proper non-targeting controls

  • Expression System Considerations:

    • Tag interference: Verify that protein tags don't interfere with localization or function

    • Expression levels: Use inducible systems to avoid artifacts from overexpression

    • Localization verification: Confirm ER membrane localization using subcellular fractionation or microscopy

  • Physiological Context:

    • Cell line selection: Choose models relevant to the physiological context (e.g., bovine cells for bovine GPX8)

    • Oxygen levels: Consider physiological oxygen tension (2-5% O₂) versus standard culture conditions (21% O₂)

    • Stress conditions: Include appropriate oxidative stress challenges (H₂O₂, tunicamycin for ER stress)

  • Activity Assays:

    • Substrate selection: Include multiple hydroperoxide substrates (H₂O₂, organic hydroperoxides)

    • Enzyme controls: Include positive controls (GPX1 or GPX4) with known activity

    • Background corrections: Control for non-enzymatic reactions and baseline activity

  • Pathway Analysis Controls:

    • Pathway inhibitors: Use specific inhibitors (e.g., STAT3 inhibitors when studying IL-6/STAT3 axis)

    • Positive controls: Include known pathway activators as controls

    • Time-course experiments: Capture both immediate and delayed responses

  • Experimental Validation Across Methods:

    • Orthogonal techniques: Verify findings using multiple methodologies

    • In vivo validation: Complement in vitro findings with animal models where possible

    • Patient sample correlation: Connect experimental findings with clinical data

What methodological approaches can resolve contradictory findings about GPX8 function in the literature?

To address contradictory findings about GPX8 function in the literature, researchers should implement these methodological strategies:

  • Standardization of Experimental Systems:

    • Consistent protein preparation: Standardize expression systems, purification methods, and storage conditions

    • Activity normalization: Develop consensus assays with standardized activity units

    • Validated reagents: Use well-characterized antibodies and detection methods with appropriate controls

  • Resolution of Catalytic Function Discrepancies:

    • Comprehensive substrate panel: Test multiple potential substrates rather than single candidates

    • Reaction conditions: Systematically vary pH, temperature, and cofactor concentrations

    • Enzyme kinetics: Perform detailed kinetic analysis (Km, kcat) to quantitatively compare activities

  • Cellular Context Considerations:

    • Cell-type specificity: Examine GPX8 function across multiple cell types

    • Stress-dependent roles: Evaluate function under both basal and stressed conditions

    • Compensatory mechanisms: Assess expression changes in other GPX family members when GPX8 is manipulated

  • Resolution of Cancer-Related Discrepancies:

    • Cancer subtype analysis: Separate analysis by cancer type and molecular subtype

    • Stage-specific effects: Evaluate GPX8 role across cancer progression stages

    • Microenvironment factors: Consider tumor microenvironment influences on GPX8 function

  • Integrative Multi-omics Approaches:

    • Combined transcriptomics/proteomics: Correlate RNA and protein level changes

    • Metabolomics integration: Connect GPX8 function to metabolic alterations

    • Structural biology: Use structural information to interpret functional findings

  • Systematic Review Methodology:

    • Meta-analysis: Perform quantitative synthesis of published results

    • Publication bias assessment: Evaluate potential for selective reporting

    • Quality assessment: Rate studies based on methodological rigor

For instance, contradictory findings regarding GPX8's role as a protein disulfide isomerase could be resolved by standardized in vitro assays combined with structural studies to determine the precise catalytic mechanism .

How can recombinant bovine GPX8 be utilized in developing new therapeutic approaches for oxidative stress-related diseases?

Recombinant bovine GPX8 offers several potential therapeutic applications for oxidative stress-related conditions:

  • Drug Discovery Platform:

    • Target-based screening: Use purified recombinant GPX8 to screen for small molecule modulators

    • Activity-based probes: Develop covalent probes to monitor GPX8 activity in various disease states

    • Structure-based drug design: Utilize 3D models of bovine GPX8 to design specific inhibitors

  • Biomarker Development:

    • Activity assays: Standardize GPX8 activity measurements in biological samples

    • Expression analysis: Correlate GPX8 levels with disease progression

    • Post-translational modifications: Investigate oxidative modifications as disease markers

  • Cancer Therapeutic Approaches:

    • GPX8 inhibition strategies: Develop specific inhibitors for cancer therapy

    • Combination approaches: Target GPX8 alongside IL-6/STAT3 pathway inhibitors

    • BET inhibitor combinations: Utilize BET inhibitors like JQ1 to downregulate GPX8

  • Protein Degradation Approaches:

    • PROTAC development: Design proteolysis-targeting chimeras specific for GPX8

    • Deubiquitylase inhibitors: Target enzymes regulating GPX8 stability

    • E3 ligase modulators: Enhance endogenous degradation pathways

  • Delivery Systems Development:

    • Enzyme replacement: Deliver functional GPX8 to deficient tissues

    • Targeted delivery: Develop tissue-specific delivery systems

    • Formulation optimization: Enhance stability and activity of recombinant protein

  • Comparative Studies for Optimization:

    • Cross-species analysis: Compare bovine GPX8 with human counterpart for therapeutic insights

    • Engineered variants: Create improved versions with enhanced stability or catalytic activity

    • Humanization strategies: Modify bovine GPX8 to reduce immunogenicity for human applications

What emerging technologies and methodologies are advancing our understanding of GPX8 function at the molecular and cellular levels?

Several cutting-edge technologies are driving new discoveries about GPX8 function:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy: Determine high-resolution structures of GPX8 in native membrane environments

    • Hydrogen-deuterium exchange mass spectrometry: Map dynamic protein regions and binding interfaces

    • NMR studies: Investigate solution dynamics of GPX8 during catalysis

  • Genome Engineering Technologies:

    • CRISPR base editors: Create precise point mutations to study structure-function relationships

    • CRISPR activation/interference: Modulate endogenous GPX8 expression without genetic deletion

    • Conditional knockout models: Generate tissue-specific or inducible GPX8 deletion systems

  • Single-Cell Analysis Technologies:

    • Single-cell RNA sequencing: Examine GPX8 expression heterogeneity in complex tissues

    • Single-cell proteomics: Quantify protein levels in individual cells

    • Spatial transcriptomics: Map GPX8 expression in tissue microenvironments

  • Advanced Imaging Techniques:

    • Super-resolution microscopy: Visualize GPX8 localization at the ER with nanometer precision

    • Live-cell redox sensors: Monitor GPX8-dependent changes in cellular redox state

    • Correlative light-electron microscopy: Connect functional data with ultrastructural context

  • Proteomics Innovations:

    • Proximity labeling: Identify proximal protein partners using BioID or APEX techniques

    • Global protein-protein interaction mapping: Apply AP-MS to comprehensively map interactome

    • Redox proteomics: Identify redox-sensitive proteins regulated by GPX8 activity

  • Computational and Systems Biology:

    • Machine learning approaches: Predict functional relationships from multi-omic data

    • Network analysis: Position GPX8 within cellular signaling networks

    • Molecular dynamics simulations: Model GPX8 behavior in membrane environments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.