Recombinant Bovine Probable palmitoyltransferase ZDHHC16 (ZDHHC16)

Shipped with Ice Packs
In Stock

Description

Palmitoylation Cascade Regulation

ZDHHC16 acts as an upstream regulator of ZDHHC6, a palmitoyltransferase targeting ER proteins like calnexin and the transferrin receptor . Key findings:

  • Activity Modulation: ZDHHC16 palmitoylates ZDHHC6 at Cys-328, enhancing its catalytic activity. Non-palmitoylated ZDHHC6 lacks detectable function .

  • Dynamic Interconversion: ZDHHC6 exists in eight palmitoylated states (C000 to C111), rapidly interconverted via ZDHHC16 and depalmitoylase APT2 .

  • Species-Specific Activity: Bovine ZDHHC16 mirrors human ZDHHC16 in substrate specificity, as demonstrated in CRISPR KO models .

Cellular Impact in Disease Models

Studies highlight ZDHHC16’s role in pathological processes:

ModelObserved EffectMechanism
Pancreatic CancerKRAS-driven upregulation linked to poor prognosis STAT3 transcriptional activation of ZDHHC16
Dental Pulp Stem CellsSuppression of osteogenic differentiation; induction of ferroptosis CREB-mediated signaling and iron metabolism regulation
Neural Stem CellsEssential for FGF/ERK pathway activation and proliferation Palmitoylation-dependent membrane localization of signaling proteins

Experimental Insights

ExperimentOutcomeImplications
ZDHHC16 OverexpressionIncreased ZDHHC6 palmitoylation and ER substrate activity Demonstrates cascade-dependent regulation of DHHC enzymes
ZDHHC16 KnockdownReduced osteogenic differentiation in DPSCs; elevated ferroptosis Links ZDHHC16 to redox balance and stem cell fate
Pegylation in TissuesHigher ZDHHC6 palmitoylation in vivo vs. cultured cells Suggests context-dependent regulation of ZDHHC16 activity

Therapeutic and Diagnostic Potential

  • Cancer Therapy: Targeting ZDHHC16 in KRAS-mutant pancreatic cancer may disrupt oncogenic signaling (e.g., MYC stabilization via ZDHHC20) .

  • Stem Cell Engineering: Modulating ZDHHC16 could enhance osteogenic differentiation for tissue repair applications .

  • Biomarker Development: ZDHHC16 expression levels correlate with disease progression in pancreatic cancer .

Comparative Analysis with Other DHHC Enzymes

EnzymeSubstrateRegulatory PartnerDisease Association
ZDHHC16ZDHHC6, CREB APT2, Selk Pancreatic cancer, osteogenesis
ZDHHC6Calnexin, Transferrin Receptor ZDHHC16, Selk ER stress, calcium signaling
ZDHHC20YTHDF3 KRAS/STAT3 Pancreatic cancer progression

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly specify them during order placement, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ZDHHC16; Palmitoyltransferase ZDHHC16; Zinc finger DHHC domain-containing protein 16; DHHC-16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
ZDHHC16
Target Protein Sequence
MRGQWSLLLGPARLCLRLLLLLGYRRRCPPLLRGLVQRWRYGKVCLRSLLYNSFGGSDTA VDAAFEPIYWLVDNVIRWCGVVFVVLVIVLTSSIVAIAYLCVLPLILQTYSVPRLCWHFF YSHWNLILIVFHYYQAITTPPGYPPQGRNDMTTVSICKKCINPKPARTHHCSICNRCVLK MDHHCPWLNNCVGHYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKL QAVANQTYHQTPPPTFSFRERVTHKSLVYLWFLCSSVALALGALTIWHAVLISRGETSIE RHINKKERQRLQAKGRVFRNHYNYGCLDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMS WDPPPWVTAHSASVMAV
Uniprot No.

Target Background

Function
Palmitoyl acyltransferase ZDHHC16 mediates palmitoylation of proteins such as PLN and ZDHHC6. It plays a crucial role in embryonic heart development and cardiac function, potentially by mediating palmitoylation of PLN, influencing PLN phosphorylation and homooligomerization. ZDHHC16 is also essential for eye development. It palmitoylates ZDHHC6, affecting the quaternary assembly of ZDHHC6, its localization, stability, and function. ZDHHC16 may participate in DNA damage response and apoptosis regulation. Furthermore, it is involved in neural stem cell proliferation by regulating the FGF/ERK pathway.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC16 and what is its primary function?

ZDHHC16 is a member of the DHHC palmitoyltransferase family responsible for catalyzing S-palmitoylation, which is the only reversible post-translational lipid modification in cells. Specifically, ZDHHC16 functions as an upstream palmitoyltransferase in a palmitoylation cascade, where it controls ZDHHC6 activity through site-specific palmitoylation . This regulatory relationship represents the first identified palmitoylation cascade in cellular systems, conceptually similar to phosphorylation cascades like the MAPK pathway .

Where is ZDHHC16 localized within cells?

Under over-expression conditions, ZDHHC16 localizes to both the endoplasmic reticulum (ER) and Golgi apparatus . This localization is consistent with its function in regulating ZDHHC6, which modifies key proteins of the endoplasmic reticulum. Unlike many other DHHC family members, ZDHHC16 itself is not palmitoylated in HeLa cells, as demonstrated by both 3H-palmitate incorporation assays and Acyl-RAC methodology .

What is the relationship between ZDHHC16 and ZDHHC6?

ZDHHC16 and ZDHHC6 form a regulatory cascade where:

  • ZDHHC16 acts as the upstream enzyme that palmitoylates ZDHHC6 on its cysteine residues

  • The two enzymes physically interact, as demonstrated by co-immunoprecipitation experiments with myc-tagged ZDHHC6 and FLAG-tagged ZDHHC16

  • They exhibit genetic interaction, where ZDHHC6 silencing or knockout leads to increased ZDHHC16 mRNA expression

  • ZDHHC16 regulates ZDHHC6 activity through modulating its palmitoylation state, which affects ZDHHC6's ability to palmitoylate its own substrates, including calnexin and transferrin receptor

How can recombinant bovine ZDHHC16 be produced for experimental use?

Recombinant full-length bovine ZDHHC16 protein can be produced using bacterial expression systems. According to the available product information, bovine ZDHHC16 (Q58CU4) spanning amino acids 1-377 can be expressed in E. coli with an N-terminal His tag for purification purposes . This approach provides a standardized source of the enzyme for in vitro studies of its activity, interaction partners, and regulatory mechanisms.

What experimental methods are most effective for studying ZDHHC16-ZDHHC6 interactions?

Several complementary approaches have proven effective for investigating the ZDHHC16-ZDHHC6 relationship:

  • Co-immunoprecipitation with tagged proteins to demonstrate physical interaction

  • Acyl-RAC (resin-assisted capture) to isolate and identify palmitoylated proteins

  • 3H-palmitate pulse-chase experiments to study palmitate turnover dynamics

  • CRISPR-Cas9 knockout of ZDHHC genes to verify specificity of enzymatic relationships

  • siRNA screens to identify enzymes involved in specific palmitoylation events

  • Site-specific mutagenesis of cysteine residues to determine palmitoylation sites

How can researchers accurately quantify ZDHHC16-mediated palmitoylation?

Multiple complementary techniques have been successfully applied:

  • Radioactive labeling: 3H-palmitate incorporation provides direct evidence of palmitoylation and allows quantification of palmitate turnover rates

  • Acyl-RAC method: Allows isolation of palmitoylated proteins without radioactivity

  • PEGylation assays: Can be used to confirm changes in palmitoylation states

  • Western blot analysis: For determining protein expression levels and stability

  • Data-driven mathematical modeling: Enables prediction of species distribution and dynamics based on experimental parameters

How does site-specific palmitoylation of ZDHHC6 by ZDHHC16 affect enzyme function and stability?

The palmitoylation state of ZDHHC6 dramatically affects both its stability and enzymatic activity. Research reveals eight differentially palmitoylated ZDHHC6 species with distinct characteristics:

  • Palmitoylation on Cys-328 strongly accelerates protein turnover, regardless of other sites (t1/2=5 hr for C100 and t1/2=0.3 hr for C111)

  • Palmitoylation on Cys-329 has a stabilizing effect on the protein

  • The non-palmitoylated form (C000) has a half-life of approximately 40 hours

  • When ZDHHC16 activity is high, the C011 species (palmitoylated on Cys-329 and Cys-330 but not Cys-328) becomes the hub of the system

  • The presence of all three palmitoylation sites renders ZDHHC6 protein content robust to changes in ZDHHC16 activity

What mathematical models exist for predicting ZDHHC16-ZDHHC6 palmitoylation dynamics?

A comprehensive mathematical model has been developed that captures the complexity of the ZDHHC6 palmitoylation system. This model:

  • Accurately predicts experimental results not used for model calibration

  • Estimates half-lives for different ZDHHC6 species

  • Models the effects of ZDHHC16 overexpression and APT2 (depalmitoylation enzyme) silencing

  • Predicts changes in species distribution under various experimental conditions

  • Enables stochastic simulations that reveal dynamic properties of the network

ZDHHC6 SpeciesPredicted Half-lifeEffect of ZDHHC16 Overexpression
C000 (non-palmitoylated)~40 hoursDecreases abundance
C100 (Cys-328 only)~5 hoursVariable
C111 (all sites)~0.3 hoursIncreases abundance
C011 (Cys-329 & Cys-330)Not specifiedBecomes dominant species (60%)

How does ZDHHC16 influence the target specificity of ZDHHC6?

Experimental evidence indicates that ZDHHC16-mediated palmitoylation of ZDHHC6 affects its ability to modify reported substrates in a cellular context:

What are common challenges when working with recombinant ZDHHC16 in experimental systems?

Working with recombinant palmitoyltransferases presents several technical challenges:

  • Maintaining enzyme activity after purification, as these are membrane proteins that require proper folding

  • Establishing appropriate in vitro assay conditions that reflect physiological activity

  • Distinguishing between auto-palmitoylation and substrate palmitoylation activities

  • Ensuring specific detection of palmitoylation events when multiple modification sites are present

  • Accounting for potential interactions with endogenous enzymes when overexpressing recombinant proteins in cellular systems

How can researchers effectively silence or knockout ZDHHC16 for functional studies?

The literature demonstrates successful approaches for manipulating ZDHHC16 expression:

  • CRISPR-Cas9 technology: Successfully used to generate ZDHHC16 knockout cell lines, particularly in the near-haploid HAP1 cell line

  • siRNA-mediated silencing: Effective for transient knockdown experiments in various cell types

  • Over-expression experiments: Complementary approach to loss-of-function studies, allowing observation of gain-of-function effects

When validating knockdown or knockout, it is essential to confirm the specificity of the effect by:

  • Measuring target protein levels via Western blot

  • Assessing effects on known substrates (e.g., calnexin and transferrin receptor palmitoylation for ZDHHC6)

  • Performing rescue experiments with WT or mutant constructs

What is the physiological significance of the ZDHHC16-ZDHHC6 palmitoylation cascade?

The ZDHHC16-ZDHHC6 cascade represents a regulatory mechanism for controlling palmitoylation of critical ER proteins, including:

  • The ER chaperone calnexin

  • The E3 ligase gp78

  • The IP3 receptor

  • The transferrin receptor

This cascade provides a sophisticated mechanism for cells to tune ZDHHC6 activity through rapid interconversion between differently palmitoylated species mediated by ZDHHC16 and the depalmitoylating enzyme APT2 . The robustness of this system suggests it may be crucial for maintaining ER homeostasis under various cellular conditions.

Are there other palmitoylation cascades similar to ZDHHC16-ZDHHC6?

The ZDHHC16-ZDHHC6 relationship represents the first identified palmitoylation cascade, conceptually similar to phosphorylation cascades like the MAPK pathway . While other cascades have not been definitively identified, the discovery of this system suggests that hierarchical regulation may be a broader feature of the palmitoylation machinery. Future research should investigate potential cascades involving other members of the 23 DHHC family enzymes in humans.

What are the most promising future directions for ZDHHC16 research?

Several research avenues hold significant promise:

  • Structural studies: Determining the three-dimensional structure of ZDHHC16 to understand its mechanism of action

  • Substrate specificity: Comprehensive profiling of ZDHHC16 substrates beyond ZDHHC6

  • Physiological regulation: Understanding how ZDHHC16 activity is controlled under various cellular conditions

  • Disease relevance: Investigating potential roles in pathological conditions

  • Systems biology approaches: Expanding mathematical models to include additional components of palmitoylation networks

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.