Recombinant Bovine Probable palmitoyltransferase ZDHHC20 (ZDHHC20)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific format requirements, please indicate them when placing your order. We will prepare your order according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
ZDHHC20; Palmitoyltransferase ZDHHC20; Acyltransferase ZDHHC20; Zinc finger DHHC domain-containing protein 20
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-365
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
ZDHHC20
Target Protein Sequence
MAPCTLWRCCQRTVGWVPVLFITFVVVWSYYAYVVELCVFTLSGNGENGKAVVYLVAFHL FFVMFVWSYWMTIFTSPASPSKEFCLSNSEKERYEKEFSQERQQEILRRAARDLPIYTTS ASKTVRYCERCQLIKPDRAHHCSACDMCILKMDHHCPWVNNCVGFSNYKFFLLFLFYSLL YCLFVATTVLQYFIKFWTNELTDTRAKFHVLFLFFVSTMFFISVLSLLSYHCWLVGKNRT TIESFRAPMFSYGTDGNGFSLGCSKNWRQVFGDEKKYWLLPVFSSQGDGCSFPTRLVGTD PEQASVSNQSESARSIGSNQPFPIKPLSESKNRLLDSDPQWLESGSEEGVGGSGTNNHVT VAIEN
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate to various protein substrates. It facilitates palmitoylation of Cys residues within the cytoplasmic C-terminus of EGFR, thereby modulating the duration of EGFR signaling. This modulation occurs through the influence of palmitoylation-dependent EGFR internalization and degradation. ZDHHC20 exhibits a preference for acyl-CoA with C16 fatty acid chains. It can also utilize acyl-CoA with C14 and C18 fatty acid chains.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region.

Q&A

What is ZDHHC20 and what are its key structural features?

ZDHHC20 (Zinc finger DHHC domain-containing protein 20) is a member of the ZDHHC family of palmitoyltransferases that catalyzes the addition of palmitate to cysteine residues on substrate proteins (S-palmitoylation). The bovine ZDHHC20 protein consists of 365 amino acids and contains the characteristic DHHC (Asp-His-His-Cys) motif that constitutes the catalytic core of these enzymes . The protein contains multiple transmembrane domains and a zinc finger DHHC domain that is essential for its enzymatic activity . The conserved cysteine residue (C156 in bovine ZDHHC20) within the DHHC motif is crucial for its catalytic function, and mutation of this residue (C156S) results in a catalytically inactive enzyme .

How should recombinant ZDHHC20 be stored and handled for optimal activity?

Recombinant bovine ZDHHC20 protein is typically supplied as a lyophilized powder and requires proper storage and handling to maintain its activity. The protein should be stored at -20°C to -80°C upon receipt, with aliquoting recommended to avoid repeated freeze-thaw cycles . For reconstitution, it should be briefly centrifuged prior to opening and then reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% is recommended for long-term storage, with 50% being the standard concentration . For working aliquots, storage at 4°C for up to one week is acceptable, but repeated freezing and thawing should be avoided as this can significantly reduce protein activity .

What are the optimal methods for assessing ZDHHC20 enzymatic activity?

Several complementary approaches can be used to assess ZDHHC20 enzymatic activity:

  • Metabolic labeling with alkyne-tagged palmitate analogs: YnPal (an alkyne-tagged analog of palmitate, C16:0) can be used to label cells expressing ZDHHC20. Following immunoprecipitation, copper-catalyzed azide-alkyne cycloaddition (CuAAC) with a fluorescent reporter (such as TAMRA) allows visualization of palmitoylated proteins by in-gel fluorescence .

  • Autoacylation assays: ZDHHC20, like other ZDHHC enzymes, undergoes autoacylation as part of its catalytic cycle. This can be assessed using similar metabolic labeling approaches followed by immunoprecipitation of the enzyme itself .

  • Substrate-specific palmitoylation assays: For known ZDHHC20 substrates like IFITM3 or PI4K2A, Western blotting following acyl-biotin exchange (ABE) or metabolic labeling can demonstrate ZDHHC20-dependent palmitoylation .

  • Chemical proteomics: For unbiased identification of ZDHHC20 substrates, chemical proteomic approaches using modified palmitate analogs coupled with mass spectrometry can be employed .

How can I effectively knockdown or overexpress ZDHHC20 in cell culture systems?

For modulating ZDHHC20 expression in cellular systems, both knockdown and overexpression approaches have been successfully employed:

Knockdown strategies:

  • Small hairpin RNA (shRNA) targeting ZDHHC20 can be used for stable knockdown. A validated sequence for shZDHHC20 is 5'-GAACAAGCTTCTGTTACAA-3' .

  • Transfection can be performed using Lipofectamine 2000 reagent and Opti-MEM at 37°C for 8 hours, followed by selection with puromycin to establish stable knockdown cell lines .

Overexpression strategies:

  • FLAG-tagged ZDHHC20 expression plasmids (e.g., in GV657 vector) can be used for overexpression studies .

  • For inducible expression, tetracycline-inducible Halo-tagged ZDHHC20 systems have been successfully implemented in HEK-derived FT-293 cells and Vero E6 cells .

What approaches can be used to identify and validate novel ZDHHC20 substrates?

Identifying and validating ZDHHC20 substrates requires a multi-faceted approach:

  • Chemical genetic approaches: Engineered ZDHHC20 mutants (such as ZDHHC20[Y181G]) can be used with modified palmitate analogs to enable specific labeling of ZDHHC20 substrates .

  • Mass spectrometry-based proteomics: Following chemical genetic labeling or traditional acyl-biotin exchange, mass spectrometry can identify S-acylated proteins and specific modification sites .

  • Validation through mutagenesis: Once candidate sites are identified, site-directed mutagenesis of predicted palmitoylation sites (e.g., converting cysteine to alanine) can confirm the exact sites of modification. Examples include validation of S-acylation at Cys76 in VAMP3 and Cys23 in BCAP31 .

  • Comparative analysis with ZDHHC20 knockdown or PROTAC-mediated degradation: Comparing the palmitoylation status of candidate substrates in ZDHHC20-depleted versus control cells can confirm ZDHHC20-dependent palmitoylation .

What are the known substrates of ZDHHC20 and what determines substrate specificity?

ZDHHC20 has several validated substrates identified through various approaches:

SubstrateValidation MethodPalmitoylation Site(s)Reference
IFITM3Chemical genetics, PROTAC-mediated degradationMultiple cysteines
PI4K2AChemical geneticsMultiple cysteines
VAMP3Chemical genetics, mutagenesisCys76
BCAP31Chemical genetics, mutagenesisCys23
TFAMChemical geneticsNot specified
XXYLT1Chemical geneticsNot specified
TOMM20Chemical geneticsNot specified

Substrate specificity is determined by multiple factors, including:

  • Structural recognition elements within substrate proteins

  • Subcellular colocalization with ZDHHC20

  • Sequence context surrounding target cysteines

  • Competition with other ZDHHC family members

The degeneracy in the ZDHHC-PAT family means that some substrates may be palmitoylated by multiple ZDHHC enzymes, which can lead to compensatory mechanisms when a single ZDHHC is inhibited .

How does ZDHHC20 substrate specificity differ across different cell types and tissues?

This context-dependent substrate specificity likely results from:

  • Differential expression of other ZDHHC family members that can compensate for ZDHHC20

  • Cell type-specific protein-protein interactions that may influence ZDHHC20 access to substrates

  • Variations in subcellular localization or trafficking of both ZDHHC20 and its substrates

  • Tissue-specific post-translational modifications that may alter ZDHHC20 activity or substrate recognition

Researchers should therefore validate ZDHHC20-substrate relationships in their specific experimental system rather than assuming universal applicability of findings from a single cell type.

What are the functional consequences of ZDHHC20-mediated palmitoylation for its substrates?

ZDHHC20-mediated palmitoylation has diverse functional consequences depending on the substrate:

  • Membrane association and trafficking: Palmitoylation generally increases protein hydrophobicity and enhances membrane association. For transmembrane proteins like IFITM3, palmitoylation can affect their lateral distribution within membranes and their trafficking between cellular compartments .

  • Protein stability: Palmitoylation can protect proteins from degradation by enhancing their membrane association and potentially shielding them from ubiquitination or other degradation signals.

  • Signaling modulation: ZDHHC20 has been implicated in activating the PI3K-AKT signaling pathway, promoting cell proliferation and tumor growth in hepatocellular carcinoma . This suggests that ZDHHC20-mediated palmitoylation modulates the activity of signaling proteins within this pathway.

  • Protein-protein interactions: The addition of palmitate can create or disrupt protein-protein interaction interfaces, thereby regulating the assembly of signaling complexes or other multiprotein assemblies.

How does ZDHHC20 contribute to cell proliferation and cancer progression?

ZDHHC20 plays a significant role in promoting cell proliferation and cancer progression, particularly in hepatocellular carcinoma (HCC). Research has demonstrated that high expression of ZDHHC20 promotes HCC cell proliferation and tumor growth by activating the PI3K-AKT signaling pathway . Multiple experimental approaches have validated this function:

  • Cell proliferation assays: ZDHHC20 knockdown reduces proliferation in HCC cell lines (SK-Hep1 and Huh7) as measured by CCK-8 assay, colony formation assay, and EDU assay .

  • Cell cycle analysis: ZDHHC20 affects cell cycle progression, with its depletion likely causing cell cycle arrest .

  • Apoptosis analysis: ZDHHC20 may protect cancer cells from apoptosis, as its knockdown increases apoptotic markers .

  • In vivo tumor growth: In nude mouse subcutaneous xenograft models, ZDHHC20 overexpression accelerates tumor growth while its knockdown reduces tumor growth .

  • Signaling pathway activation: Mechanistically, ZDHHC20 activates the PI3K-AKT signaling pathway, as evidenced by changes in phosphorylation levels of PI3K and AKT upon ZDHHC20 modulation .

What strategies can be employed to target ZDHHC20 for therapeutic purposes?

Several approaches show promise for targeting ZDHHC20 in therapeutic contexts:

  • PROTAC-mediated degradation: Proteolysis-targeting chimeras (PROTACs) can be used to selectively degrade ZDHHC20. In proof-of-principle experiments, Halo-tagged ZDHHC20 was successfully degraded using Halo-PROTACs, resulting in decreased palmitoylation of its substrate IFITM3 in HEK-derived cells .

  • RNA interference: shRNA targeting ZDHHC20 has been used successfully to knock down its expression in hepatocellular carcinoma cells, reducing cell proliferation and tumor growth . This approach could be adapted for therapeutic development.

  • Chemical inhibition: While not described in the provided sources, development of specific small molecule inhibitors targeting ZDHHC20's catalytic activity represents another potential therapeutic strategy.

  • Substrate-specific intervention: In cases where the pathological effects of ZDHHC20 are mediated through specific substrates, targeting the palmitoylation sites on those substrates or their downstream effects might provide therapeutic benefit with fewer off-target effects.

When considering these approaches, researchers should account for the potential compensatory mechanisms by other ZDHHC family members, as the degeneracy in the ZDHHC-PAT family may limit the efficacy of targeting a single enzyme .

How does ZDHHC20 interact with viral proteins and impact viral infections?

The interaction between ZDHHC20 and viral proteins has important implications for viral infections. In studies examining the SARS-CoV-2 spike protein, which is known to undergo palmitoylation, researchers investigated whether ZDHHC20 contributes to this modification . Interestingly, in Vero E6 cells, degradation of Halo-ZDHHC20 did not alter the palmitoylation status of the SARS-CoV-2 spike protein , suggesting that other ZDHHC enzymes may be primarily responsible for spike protein palmitoylation in these cells.

How can chemical genetic approaches be optimized for studying ZDHHC20-specific palmitoylation?

Chemical genetic approaches offer powerful tools for studying ZDHHC20-specific palmitoylation events. These can be optimized through several strategies:

  • Engineered ZDHHC20 mutants: The ZDHHC20[Y181G] mutant has been identified as an effective tool, showing labeling equivalent to wild-type ZDHHC20 while enabling selective substrate identification . This mutant can accept modified palmitate analogs that cannot be utilized by wild-type enzymes.

  • Optimized palmitate analogs: Testing different chain lengths and bump sizes of alkyne-tagged palmitate analogs can maximize selectivity for mutant ZDHHC20 over wild-type enzymes. The analog 18-Bz has been validated for use with ZDHHC20[Y181G] .

  • Temporal control: Utilizing inducible expression systems, such as tetracycline-inducible Halo-tagged ZDHHC20, allows for precise temporal control of ZDHHC20 activity , facilitating studies of dynamic palmitoylation events.

  • Combined approaches: Integrating chemical genetics with proteomics, mutation analysis of substrate sites, and bioinformatic prediction algorithms can provide comprehensive validation of ZDHHC20 substrates and their palmitoylation sites .

When implementing these approaches, researchers should validate results using multiple methods, including site-directed mutagenesis of putative palmitoylation sites on candidate substrates (as demonstrated for VAMP3 Cys76 and BCAP31 Cys23) .

What are the challenges in developing isoform-specific inhibitors for ZDHHC20?

Developing isoform-specific inhibitors for ZDHHC20 presents several significant challenges:

  • Conserved active site: The extensive conservation of the ZDHHC-PAT active site across family members makes development of isoform-specific competitive inhibitors highly challenging . The catalytic DHHC motif and surrounding regions show substantial homology among the 23 human ZDHHC enzymes.

  • Substrate degeneracy: Multiple ZDHHC enzymes often have overlapping substrate specificities, which means inhibiting a single enzyme like ZDHHC20 may not completely abolish substrate palmitoylation due to compensatory activity from other family members .

  • Context-dependent activity: The activity and substrate specificity of ZDHHC20 varies across cell types and tissues, complicating the development of universally effective inhibitors . What works in one cellular context may not translate to others.

  • Membrane protein challenges: As an integral membrane protein with multiple transmembrane domains, ZDHHC20 presents additional challenges for structural studies and inhibitor design compared to soluble enzymes.

These challenges have led researchers to explore alternative approaches such as PROTAC-mediated degradation, which may offer greater specificity than active site inhibitors by targeting unique surface features of ZDHHC20 rather than the conserved catalytic domain .

How might comparative studies across different ZDHHC family members inform our understanding of ZDHHC20?

Comparative studies across ZDHHC family members can significantly advance our understanding of ZDHHC20 through several approaches:

  • Substrate network analysis: Chemical genetic systems have been developed for multiple ZDHHC enzymes, including ZDHHCs 3, 7, 11, 15, and 20 . Comparing substrate networks across these enzymes can reveal:

    • Unique versus shared substrates

    • Differential substrate preferences based on structural or sequence features

    • Compensatory relationships between enzymes

  • Structural comparisons: While structural information wasn't explicitly mentioned in the search results, comparative structural analysis of ZDHHC family members could identify unique features of ZDHHC20 that might be exploited for selective targeting.

  • Functional redundancy analysis: The observation that ZDHHC20 degradation affects IFITM3 palmitoylation in HEK-derived cells but not in Vero E6 cells highlights the importance of understanding which ZDHHC enzymes can compensate for each other in different contexts . Systematic studies across cell types could map these redundancy networks.

  • Evolution and conservation: Comparative genomic analyses across species (not addressed in the provided sources) could reveal conserved versus divergent features of ZDHHC20, potentially highlighting functionally critical regions.

Such comparative approaches are particularly important given the extensive degeneracy in the ZDHHC-PAT family , which suggests that understanding ZDHHC20 in isolation may provide an incomplete picture of its biological roles and therapeutic potential.

What are the most promising future directions for ZDHHC20 research?

Based on current findings, several promising directions for future ZDHHC20 research emerge:

  • Comprehensive substrate identification: While several ZDHHC20 substrates have been identified, including IFITM3, PI4K2A, VAMP3, and BCAP31 , a more comprehensive characterization of the ZDHHC20 substrate network across different cell types and tissues would provide valuable insights into its biological functions.

  • Therapeutic targeting in cancer: Given the role of ZDHHC20 in activating the PI3K-AKT signaling pathway and promoting cell proliferation and tumor growth in hepatocellular carcinoma , further investigation of its therapeutic potential in cancer is warranted. This includes development of PROTAC-based approaches or other selective targeting strategies.

  • Cell type-specific functions: The observation that ZDHHC20 function varies across cell types suggests important context-dependent roles that remain to be fully elucidated. Systematic studies across diverse cell types and tissues could reveal tissue-specific functions and regulatory mechanisms.

  • Antiviral implications: The relationship between ZDHHC20 and antiviral factors like IFITM3 , as well as its potential interaction with viral proteins like the SARS-CoV-2 spike, suggests that further investigation of ZDHHC20 in viral infections could yield important insights.

  • Development of improved chemical tools: Refinement of chemical genetic approaches and PROTAC-based degradation strategies would facilitate more precise studies of ZDHHC20 function in complex biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.