Recombinant Bovine Probable palmitoyltransferase ZDHHC21 (ZDHHC21)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Bovine Probable Palmitoyltransferase ZDHHC21 (ZDHHC21) is a bioengineered protein derived from the bovine homolog of the human ZDHHC21 gene. It belongs to the DHHC (Asp-His-His-Cys) family of palmitoyltransferases, enzymes responsible for attaching palmitoyl groups to cysteine residues in target proteins via thioester bonds. This post-translational modification regulates protein stability, membrane localization, and signaling in diverse cellular processes .

The recombinant protein is expressed in bacterial systems (e.g., E. coli) and purified to >90% homogeneity, often with an N-terminal His-tag for enhanced solubility and purification . Its primary use lies in studying palmitoylation mechanisms, substrate interactions, and therapeutic applications, particularly in diseases like cancer and endothelial dysfunction .

Key Properties

PropertyValueSource
Gene NameZDHHC21
Host OrganismBos taurus (Bovine)
Expression SystemE. coli
Molecular Weight31,384.94 Da
pI8.434
Purity>90% (SDS-PAGE)
SequenceFull-length (1-265 residues) with N-terminal His-tag

Sequence Analysis

The recombinant protein includes the entire bovine ZDHHC21 sequence (UniProt ID: A2VDT6), featuring a conserved DHHC catalytic domain essential for palmitoylation activity . Its sequence aligns with motifs critical for enzyme-substrate interactions, including zinc fingers and hydrophobic regions .

Functional Significance in Research

ZDHHC21 catalyzes palmitoylation of specific substrates, influencing cellular processes such as oxidative phosphorylation (OXPHOS), endothelial barrier integrity, and cancer metabolism. Below are key substrates and their biological roles:

SubstrateFunctionRelevanceSource
PECAM1Endothelial cell adhesion and migrationReduced surface expression in ZDHHC21 knockdown
PLCβ1Phospholipase C signaling in endothelial barrier dysfunctionPalmitoylation enhances signaling
AK2Mitochondrial ATP synthesis in AML cellsPalmitoylation activates OXPHOS
FASNFatty acid synthesis in DLBCLPalmitoylation reduces stability

Mechanistic Insights

Recombinant ZDHHC21 is used to study substrate specificity and enzymatic activity in vitro. For example:

  • PLCβ1 Palmitoylation: In endothelial cells, ZDHHC21-mediated palmitoylation of PLCβ1 at Cys17 enhances its membrane localization and downstream signaling (e.g., IP3 production and calcium mobilization) .

  • FASN Palmitoylation: In diffuse large B-cell lymphoma (DLBCL), ZDHHC21 palmitoylates FASN at Cys1317, destabilizing the enzyme and inhibiting fatty acid synthesis .

Experimental Uses

  1. Palmitoylation Assays: Recombinant ZDHHC21 is employed in biochemical assays to identify palmitoylation targets and validate substrate interactions .

  2. Therapeutic Targeting:

    • AML: Inhibition of ZDHHC21 suppresses OXPHOS hyperactivity in leukemia stem cells (LSCs), inducing differentiation and enhancing chemotherapy efficacy .

    • DLBCL: Modulating ZDHHC21/FASN axis with lanatoside C reduces tumor growth by disrupting fatty acid synthesis .

Challenges

  • Activity Retention: Ensuring proper folding and catalytic activity in recombinant proteins remains a technical hurdle.

  • Species Specificity: Bovine ZDHHC21 may exhibit differences in substrate preference compared to human homologs, necessitating cross-species validation .

Table 1: Recombinant ZDHHC21 Variants

SpeciesHostTagPuritySource
BovineE. coliHis>90%
MouseCell-freeNone>85%
HumanMammalianHis>85%

Table 2: Substrate-Specific Functions

SubstratePalmitoylation SiteBiological ImpactDisease RelevanceSource
PLCβ1Cys17Endothelial barrier disruptionInflammation
AK2N/AOXPHOS activationAML
FASNCys1317Fatty acid synthesis inhibitionDLBCL

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ZDHHC21; Palmitoyltransferase ZDHHC21; Zinc finger DHHC domain-containing protein 21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
ZDHHC21
Target Protein Sequence
MGLRIHFVVDPHGWCCMGLIVFVWLYNFFLIPKIVLFPHYEEGHIPGILIIIFYGIAMFC LVALVRASITDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC PWINNCVGEDNHWLFLQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVVRHELAIM RLAAFMGITMLVGITGLFYTQLIGIITDTTSIEKMSNCCEEISRPRKPWQQTFSEVFGTR WKILWFIPFRRRQPLRVPYHFANHV
Uniprot No.

Target Background

Function
Palmitoyltransferase catalyzes the addition of palmitate to various protein substrates. It palmitoylates sex steroid hormone receptors, including ESR1, PGR, and AR, regulating their targeting to the plasma membrane. This impacts rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect signaling mediated by their nuclear receptors. Palmitoylates FYN, regulates its localization in hair follicles, and plays a crucial role in epidermal homeostasis and hair follicle differentiation. Through the palmitoylation of PLCB1 and the regulation of downstream signaling, it indirectly regulates the function of the endothelial barrier and leukocyte adhesion to the endothelium. It also exhibits palmitoyltransferase activity towards ADRA1D, positively regulating its activity and expression. This may contribute to vascular contraction. It may also palmitoylate eNOS and LCK.
Database Links
Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What are the known functional domains of ZDHHC21 and how do they relate to its enzymatic activity?

ZDHHC21 contains the characteristic DHHC domain (Asp-His-His-Cys) that defines the ZDHHC family of palmitoyl S-acyltransferases. This catalytic domain is essential for its palmitoyltransferase activity, facilitating the transfer of palmitate to specific cysteine residues on target proteins. Research has identified ZDHHC21 as functionally significant in:

  • Mediating S-palmitoylation of FASN at Cys1317, resulting in decreased protein stability and reduced fatty acid synthesis

  • Palmitoylating serotonin receptor 5-HT1A, with direct evidence of interaction between the two proteins

The zinc finger structure within the DHHC domain facilitates substrate recognition and binding, making it critical for ZDHHC21's specificity toward its target proteins.

How is ZDHHC21 different from other members of the ZDHHC family?

While ZDHHC21 shares the characteristic DHHC catalytic domain with other family members, it displays several distinguishing features:

  • Subcellular localization: ZDHHC21 is primarily localized to the Golgi apparatus, unlike some family members such as ZDHHC5 which resides at the plasma membrane

  • Substrate specificity: ZDHHC21 shows preferential palmitoylation activity toward specific proteins including FASN and 5-HT1AR

  • Sequence homology: ZDHHC21 exhibits relatively low sequence homology with other ZDHHC family members (approximately 26-29% homology with ZDHHC5 and ZDHHC9), while maintaining high conservation (about 98% homology) between different mammalian species

This suggests that despite shared catalytic mechanisms, ZDHHC21 likely plays specialized physiological roles distinct from other family members.

What is the mechanism by which ZDHHC21 regulates FASN through palmitoylation?

ZDHHC21 exhibits a novel regulatory mechanism for FASN through the following pathway:

  • Direct interaction: ZDHHC21 physically interacts with FASN as demonstrated through co-immunoprecipitation studies

  • Site-specific palmitoylation: ZDHHC21 mediates the palmitoylation of FASN specifically at cysteine residue 1317 (Cys1317)

  • Protein stability regulation: This palmitoylation event leads to decreased FASN protein stability, effectively reducing the cellular levels of functional FASN

  • Metabolic consequences: The reduction in FASN stability results in decreased fatty acid synthesis within the cell

  • Phenotypic outcome: The suppression of fatty acid synthesis contributes to inhibition of cell proliferation, particularly observed in DLBCL cells

This mechanism represents a previously unrecognized post-translational regulatory pathway for FASN, with significant implications for understanding lipid metabolism in both normal and pathological conditions.

How does ZDHHC21 expression correlate with clinical outcomes in cancer research?

Analysis of ZDHHC21 expression in clinical samples has revealed significant correlations with disease outcomes:

These findings suggest ZDHHC21 functions as a tumor suppressor in DLBCL, with potential utility as both a prognostic biomarker and therapeutic target.

What mechanisms regulate ZDHHC21 expression in normal and pathological states?

Research has identified several mechanisms that regulate ZDHHC21 expression:

  • Genetic alterations:

    • Copy number variations: Heterozygous deletion in the ZDHHC21 locus occurs in approximately 6.25% of DLBCL cases

    • Mutations: Mutations in the ZDHHC21 locus are rare, observed in only 0.74% of DLBCL cases

  • Epigenetic regulation:

    • DNA methylation: Methylation levels at specific CpG sites (probes cg01785060 and cg00775695) negatively correlate with ZDHHC21 expression levels

  • Transcriptional regulation:

    • Transcription factor binding: The ZDHHC21 promoter contains potential binding sites for NFKB1, NFKB2, and STAT3

    • Subtype-specific correlation: NFKB1 and NFKB2 expression negatively correlates with ZDHHC21 expression in ABC subtype DLBCL, while STAT3 expression negatively correlates with ZDHHC21 expression in GCB subtype DLBCL

These diverse regulatory mechanisms suggest complex control of ZDHHC21 expression that may be exploited therapeutically in disease contexts.

What are the optimal conditions for reconstitution and storage of recombinant bovine ZDHHC21?

For optimal activity and stability of recombinant bovine ZDHHC21:

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended 50% for long-term storage)

  • Storage conditions:

    • Store reconstituted protein in aliquots at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • For short-term use, working aliquots may be stored at 4°C for up to one week

  • Buffer considerations:

    • The protein is supplied in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

Adherence to these guidelines ensures maximum retention of ZDHHC21's enzymatic activity for experimental applications.

What assays can be used to measure ZDHHC21 palmitoyltransferase activity?

Several complementary approaches can be employed to assess ZDHHC21 palmitoyltransferase activity:

  • Metabolic labeling:

    • Cells expressing ZDHHC21 and potential substrates are metabolically labeled with [9,10(n)³H]-palmitic acid

    • After immunoprecipitation of the substrate protein, incorporated radioactivity is measured to quantify palmitoylation

  • Acyl-Biotin Exchange (ABE) technique:

    • This non-radioactive method involves:
      a) Blocking free thiols with N-ethylmaleimide
      b) Specific cleavage of thioester bonds with hydroxylamine
      c) Labeling newly exposed thiols with biotin
      d) Detection via Western blotting or mass spectrometry

  • Functional readouts for specific substrates:

    • For 5-HT1AR: Measure G protein-coupled inwardly rectifying potassium (GIRK) currents using electrophysiological techniques

    • For FASN: Assess fatty acid synthesis rates and FASN protein stability through pulse-chase experiments

  • Cell proliferation assays:

    • CCK8 (Cell Counting Kit-8) assay to measure cell viability as a downstream consequence of ZDHHC21-mediated palmitoylation of proteins involved in proliferation pathways

A combination of these approaches provides comprehensive assessment of ZDHHC21 activity.

What in vivo models are available for studying ZDHHC21 function?

Several animal models have been developed to study ZDHHC21 function in vivo:

  • ZDHHC21-deficient mouse model (Zdhhc21^dep/dep):

    • Contains a spontaneous 3-bp deletion in the coding region of the Zdhhc21 gene

    • Results in non-functional ZDHHC21 protein

    • Shows impaired palmitoylation of 5-HT1AR in the brains of newborn mice

    • Exhibits developmental compensation, as adult mice show normalized palmitoylation levels

  • Xenograft models:

    • BALB/c nude mice injected with DLBCL cells having modified ZDHHC21 expression

    • Protocol typically involves subcutaneous injection of 1×10^7 cells with altered ZDHHC21 expression

    • Tumor volumes measured every two days for approximately four weeks

    • Enables assessment of ZDHHC21's effect on tumor growth in vivo

  • Pharmacological intervention models:

    • Treatment with lanatoside C, which interacts with ZDHHC21 and increases its protein stability

    • Allows for assessment of therapeutic targeting of the ZDHHC21/FASN axis

These models provide valuable platforms for investigating ZDHHC21's physiological and pathological roles in complex biological systems.

What technical considerations should be addressed when performing co-immunoprecipitation studies with ZDHHC21?

When conducting co-immunoprecipitation (co-IP) studies with ZDHHC21:

  • Tag selection and positioning:

    • N-terminal tags (such as HA or GFP) are preferred as C-terminal modifications may interfere with the DHHC domain

    • For substrate proteins, consider potential interference of tags with palmitoylation sites

  • Expression systems:

    • Neuroblastoma N1E cells have been successfully used for co-expression of ZDHHC21 and potential substrates

    • Consider using ZDHHC21's natural cellular environment (like B-cell lines for FASN interaction studies)

  • Control experiments:

    • Include non-palmitoylating ZDHHC21 mutants as negative controls

    • Use known ZDHHC21 substrates (such as 5-HT1AR or FASN) as positive controls

    • Include immunoprecipitation with non-specific IgG to control for non-specific binding

  • Detection methods:

    • Western blotting with specific antibodies for each protein

    • Consider palmitoylation state analysis in parallel using ABE or metabolic labeling to correlate interaction with enzymatic activity

These considerations help ensure specific and physiologically relevant detection of ZDHHC21-substrate interactions.

How might therapeutic targeting of ZDHHC21 be developed for cancer treatment?

Based on current research, several promising approaches for ZDHHC21-targeted therapeutics include:

  • Small molecule enhancers:

    • Lanatoside C has been identified as an FDA-approved compound that interacts with ZDHHC21

    • It increases ZDHHC21 protein stability and decreases FASN expression

    • This contributes to suppression of DLBCL growth both in vitro and in vivo

  • Substrate-specific approach:

    • Developing molecules that specifically enhance ZDHHC21-mediated palmitoylation of tumor suppressors

    • Targeting the ZDHHC21/FASN interaction interface to promote FASN palmitoylation and subsequent degradation

  • Expression restoration strategies:

    • Targeting transcription factors (NFKB1, NFKB2, STAT3) that repress ZDHHC21 expression

    • Epigenetic approaches targeting methylation sites (cg01785060, cg00775695) that regulate ZDHHC21 expression

  • Combination therapy potential:

    • Synergistic approaches combining ZDHHC21 activation with direct FASN inhibitors

    • Integration with standard lymphoma treatments to enhance efficacy and reduce resistance

These approaches represent promising avenues for translating ZDHHC21 research into clinical applications for DLBCL and potentially other cancers.

What is the developmental significance of ZDHHC21's role in receptor palmitoylation?

The developmental importance of ZDHHC21 is highlighted by several observations:

Further research is needed to fully elucidate the temporal dynamics of ZDHHC21 function during development and the mechanisms underlying compensatory responses in its absence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.