Recombinant Bovine Probable palmitoyltransferase ZDHHC4 (ZDHHC4)

Shipped with Ice Packs
In Stock

Description

Enzymatic Activity

ZDHHC4 catalyzes S-palmitoylation, transferring palmitate to cysteine residues on substrate proteins. While bovine-specific substrates are not yet characterized, studies on homologs reveal:

  • Substrate Diversity: Human ZDHHC4 palmitoylates TRPV1 at Cys157, Cys362, Cys390, and Cys715, promoting lysosomal degradation and pain regulation .

  • Fatty Acid Selectivity: Unlike zDHHC3/7, ZDHHC4 shows no preference for C14:0, C16:0, or C18:0 fatty acids, suggesting broad substrate flexibility .

Research Applications

Recombinant Bovine ZDHHC4 is primarily used to:

  1. Investigate palmitoylation mechanisms in lipid metabolism.

  2. Develop inhibitors/activators for therapeutic targeting (e.g., pain management, cancer) .

  3. Study enzyme-substrate interactions via co-immunoprecipitation or fluorescence complementation assays .

Table 3: Cross-Species Functional Comparisons

SpeciesKey FunctionReference
Rhesus MonkeyRegulates TRPV1 degradation via palmitoylation; lysosomal targeting
HumanStabilizes GPX4 to suppress ferroptosis; implicated in cancer progression
MouseModulates TRPV1-mediated nociception; co-localizes with JAK2-STAT3 signaling

Challenges and Future Directions

While bovine ZDHHC4’s role in livestock biology remains underexplored, its structural conservation with human and murine isoforms suggests relevance in:

  • Disease Models: Ferroptosis resistance in bovine cell lines.

  • Agricultural Biotechnology: Enhancing stress tolerance in livestock through protein stability modulation.

Further studies are needed to map bovine-specific substrates and regulatory pathways.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag.
Synonyms
ZDHHC4; Palmitoyltransferase ZDHHC4; Zinc finger DHHC domain-containing protein 4; DHHC-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
ZDHHC4
Target Protein Sequence
MDFLVLFLLYLALVLLGFVMICIGSKTHYLQGLISRGAQVFSYIIPECLQRAMLSVLHYL FHTRNYTFVVLHLILQGMVYTEYTWEIFGLCQQLEFSLYYLFLPYLLLIVNLLFFTLSCV TNPGTITKANELLFLQVYEFDGVMFPKNVRCPTCDLRKPARSKHCSVCNRCVHRFDHHCV WVNNCIGAWNTRYFLSYLFTLTASAATMAVVSTVFLVRLVVMSDVYLQTYVDDLGHLQVV DTVFLVQYLFLTFPRIVFLVGFVVVLSFLLGGYLCFCLYLAATNQTTNEWYKGDRAWCQH CPHVARPPAAEPQAYRNIHSHGLWSNLREIFLPATACYERKEK
Uniprot No.

Target Background

Function
Palmitoyltransferase that catalyzes the addition of palmitate onto protein substrates, including the D(2) dopamine receptor DRD2.
Database Links

KEGG: bta:514338

STRING: 9913.ENSBTAP00000012560

UniGene: Bt.4145

Protein Families
DHHC palmitoyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Q&A

What is ZDHHC4 and what is its primary function?

ZDHHC4 is a palmitoyl transferase belonging to the ZDHHC family that catalyzes protein S-palmitoylation, the covalent attachment of the 16-carbon fatty acid palmitate to cysteine residues in target proteins. This post-translational modification is reversible and plays crucial roles in protein trafficking, stability, and function. ZDHHC4 contains the characteristic DHHC (Asp-His-His-Cys) domain that is essential for its enzymatic activity . Removal of this domain, as demonstrated in ZDHHC4(ΔDHHC) truncation experiments, eliminates its palmitoyl transferase activity and subsequent regulatory effects on target proteins .

What is the cellular localization of ZDHHC4?

ZDHHC4 primarily localizes to the plasma membrane, where it can interact with its substrate proteins. Confocal microscopy studies have confirmed this localization pattern, particularly through experiments showing colocalization of mCherry-tagged TRPV1 and GFP-tagged ZDHHC4 on the plasma membrane in HEK293T cells . Bimolecular fluorescence complementation (BiFC) imaging has further validated this physical interaction, with reconstituted green fluorescence observed on the cell plasma membrane when CsfGFP-tagged TRPV1 and NsfGFP-tagged ZDHHC4 interact .

How does ZDHHC4 differ from other members of the ZDHHC family?

While all ZDHHC family members share the conserved DHHC domain, ZDHHC4 exhibits distinct substrate specificity and tissue distribution patterns. Out of 23 mammalian ZDHHC palmitoylases, ZDHHC4 specifically interacts with and downregulates TRPV1, while other family members like ZDHHC2, ZDHHC12, ZDHHC15, ZDHHC17, and ZDHHC18 do not demonstrate this interaction despite showing expression changes during inflammatory pain resolution . This substrate selectivity likely stems from differences in protein-protein interaction domains outside the catalytic DHHC region.

What are the known substrates of ZDHHC4?

ZDHHC4 has been identified to palmitoylate specific substrate proteins, most notably:

  • TRPV1 (Transient Receptor Potential Vanilloid 1) - ZDHHC4 palmitoylates TRPV1 at cysteine residues C157, C362, C390, and C715, promoting its degradation via the lysosomal pathway .

  • Potential cancer-related substrates - Elevated expression of ZDHHC4 in lung adenocarcinoma (LUAD) suggests it may palmitoylate proteins involved in tumor progression .

What experimental approaches are most effective for confirming ZDHHC4-substrate interactions?

Multiple complementary techniques should be employed to robustly validate ZDHHC4-substrate interactions:

  • Co-immunoprecipitation (Co-IP) - This technique can identify physical interactions between ZDHHC4 and potential substrates. For example, Co-IP assays showed that GFP-tagged ZDHHC4, but not other ZDHHCs, interacted with Flag-tagged TRPV1 .

  • Bimolecular Fluorescence Complementation (BiFC) - This approach visualizes protein-protein interactions in living cells. When TRPV1 and ZDHHC4 were tagged with complementary GFP fragments (CsfGFP and NsfGFP), their interaction resulted in reconstituted green fluorescence specifically at the plasma membrane .

  • Confocal Microscopy - Colocalization studies using fluorescently tagged proteins (e.g., mCherry-TRPV1 and GFP-ZDHHC4) can visually confirm their spatial proximity .

  • Acyl-Biotin Exchange (ABE) Assay - This biochemical method specifically detects protein palmitoylation. Overexpression of ZDHHC4 in ND7/23 cells enhanced endogenous TRPV1 palmitoylation as demonstrated by ABE assay, while ZDHHC4 knockdown using shRNA significantly reduced TRPV1 palmitoylation .

  • Domain Mapping - Constructing truncated proteins helps identify interaction domains. For TRPV1, studies showed that ZDHHC4 strongly interacted with both the N-terminus (aa 1-432) and C-terminus (aa 687-839), while the transmembrane domain was not involved .

How can recombinant ZDHHC4 activity be measured in vitro?

Measuring recombinant ZDHHC4 activity requires specialized assays that detect the transfer of palmitate to substrate proteins:

  • Acyl-Biotin Exchange (ABE) Assay - This three-step process involves: (1) blocking free thiols with N-ethylmaleimide, (2) cleaving palmitoyl-thioester bonds with hydroxylamine, and (3) labeling newly exposed thiols with a biotin derivative for detection .

  • Metabolic Labeling - Cells expressing recombinant ZDHHC4 and its substrate are incubated with radiolabeled palmitate (typically [3H]-palmitate) or click chemistry-compatible palmitate analogs (e.g., 17-octadecynoic acid) to track palmitoylation .

  • Fluorescence-Based Assays - These assays monitor changes in substrate localization or function following palmitoylation by ZDHHC4.

  • Palmitoylation Inhibition - 2-bromopalmitate (2-BP), a non-metabolizable palmitate analog, can be used as a control to prevent the incorporation of palmitate by palmitoyl transferases like ZDHHC4 .

What are the critical technical considerations when working with recombinant bovine ZDHHC4?

Working with recombinant bovine ZDHHC4 presents several technical challenges that require careful consideration:

  • Expression System Selection - ZDHHC4 is a multi-pass transmembrane protein, making mammalian expression systems like HEK293T cells preferable over bacterial systems to ensure proper folding and post-translational modifications .

  • Purification Strategy - Detergent selection is critical when extracting and purifying membrane proteins like ZDHHC4. Mild non-ionic detergents (e.g., DDM, LMNG) are recommended to maintain native conformation and activity.

  • Activity Preservation - ZDHHC4 requires its DHHC domain for enzymatic activity. Truncation experiments have demonstrated that removal of this domain eliminates palmitoylation activity .

  • Substrate Co-expression - For functional studies, co-expression of ZDHHC4 with its substrate proteins (e.g., TRPV1) in appropriate cell systems is necessary to observe palmitoylation-dependent effects .

  • Mutation Strategies - Site-directed mutagenesis can be used to generate catalytically inactive ZDHHC4 variants (e.g., by mutating the cysteine in the DHHC motif) as negative controls for palmitoylation studies .

What mechanisms regulate ZDHHC4 expression and activity?

ZDHHC4 expression and activity are regulated through multiple mechanisms:

  • Transcriptional Regulation - ZDHHC4 mRNA levels progressively increase during inflammatory pain resolution, suggesting transcriptional upregulation in response to inflammatory stimuli .

  • Post-translational Modifications - Like other ZDHHCs, ZDHHC4 itself may undergo auto-palmitoylation, which can affect its stability and activity.

  • Protein-Protein Interactions - Specific protein interactions may enhance or inhibit ZDHHC4 activity in different cellular contexts.

  • Disease-Associated Regulation - In lung adenocarcinoma (LUAD), ZDHHC4 is significantly upregulated compared to normal lung tissue, indicating disease-specific transcriptional control mechanisms .

What is the role of ZDHHC4 in pain modulation and nociception?

ZDHHC4 plays a critical role in inflammatory pain resolution through its palmitoylation of TRPV1:

  • Mechanism of Action - ZDHHC4 directly palmitoylates TRPV1 at four specific cysteine residues (C157, C362, C390, and C715), promoting TRPV1 degradation via the lysosomal pathway . This process reduces the availability of functional TRPV1 channels and consequently decreases pain sensitivity.

  • Temporal Expression Pattern - During inflammatory pain resolution, ZDHHC4 mRNA levels progressively increase over time, paralleling enhanced TRPV1 palmitoylation and subsequent protein degradation .

  • Functional Consequences - Electrophysiological studies demonstrate that ZDHHC4 coexpression significantly reduces TRPV1 current density in response to multiple stimuli (capsaicin, acid, and heat), without affecting channel sensitivity to agonists or temperature .

  • In Vivo Effects - ZDHHC4 knockdown mice exhibit enhanced nocifensive behavior in response to intraplantar capsaicin injection, highlighting the physiological importance of ZDHHC4 in pain modulation .

What is the evidence for ZDHHC4's role in cancer progression?

Emerging evidence suggests ZDHHC4 may contribute to cancer pathogenesis:

  • Expression Analysis - ZDHHC4 mRNA expression is significantly upregulated in lung adenocarcinoma (LUAD) compared to normal lung tissue .

  • Prognostic Value - High expression of ZDHHC4 is associated with poor prognosis in LUAD patients, suggesting its potential as a prognostic biomarker .

  • Molecular Function - While specific mechanisms remain under investigation, ZDHHC4's palmitoyltransferase activity may modify oncogenic proteins, affecting their localization, stability, or signaling capabilities.

  • Tumor Microenvironment - ZDHHC4 expression levels could be related to the tumor microenvironment in LUAD, potentially influencing immune cell infiltration or stromal interactions .

How does ZDHHC4 interact with depalmitoylating enzymes to regulate substrate function?

ZDHHC4 functions in balance with depalmitoylating enzymes:

  • APT1 Counterregulation - The depalmitoylase APT1 counteracts ZDHHC4-mediated palmitoylation of TRPV1, maintaining a dynamic equilibrium of TRPV1 protein levels .

  • In Vivo Evidence - While ZDHHC4 knockdown mice show enhanced nocifensive behavior, APT1 knockdown mice exhibit attenuated responses to capsaicin, demonstrating the opposing effects of palmitoylation versus depalmitoylation .

  • Therapeutic Implications - This balance between ZDHHC4 and APT1 activities represents a potential target for pain management interventions, where manipulating the palmitoylation/depalmitoylation equilibrium could modulate pain sensitivity .

What are the optimal methods for generating ZDHHC4 mutant constructs?

Based on published research strategies, the following approaches are recommended for generating ZDHHC4 mutant constructs:

  • Site-Directed Mutagenesis - This technique is effective for introducing specific mutations into ZDHHC4, particularly for creating catalytically inactive variants by modifying the DHHC domain .

  • Domain Swapping - For studying domain functions, chimeras can be created by swapping domains between related ZDHHC family members. This approach has been successfully used with zDHHC3 and zDHHC7, inserting restriction sites at domain boundaries followed by restriction/ligation .

  • Truncation Constructs - Generating truncated versions of ZDHHC4 lacking specific domains (e.g., ZDHHC4(ΔDHHC)) helps determine the functional importance of those regions .

  • GeneArt Synthesis - For complex modifications, particularly involving transmembrane domains, gene synthesis services like GeneArt can be employed to construct the desired sequences before subcloning into expression vectors .

  • Validation Methods - All mutant constructs should be confirmed by sequencing before use in functional studies .

What experimental approaches can identify ZDHHC4 palmitoylation sites on target proteins?

Identifying specific palmitoylation sites requires a systematic approach:

  • Site-Directed Mutagenesis of Predicted Sites - Systematic mutation of candidate cysteine residues to alanine in the substrate protein, followed by palmitoylation assays, can identify critical sites. For TRPV1, mutation of C157, C362, C390, and C715 to alanine individually reduced ZDHHC4-mediated palmitoylation, while the quadruple mutant (4CA) completely abolished it .

  • Mass Spectrometry - This technique can directly identify palmitoylated peptides and their modification sites through:

    • Acyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC) followed by LC-MS/MS

    • Direct detection of palmitoylated peptides using specialized MS methods

  • Functional Validation - Confirm the physiological relevance of identified sites by testing whether mutation affects:

    • Protein localization

    • Protein stability/degradation rates

    • Functional responses (e.g., TRPV1 current density in electrophysiological assays)

What is the recommended experimental design for studying ZDHHC4 in pain modulation?

Based on published approaches, a comprehensive experimental design for studying ZDHHC4 in pain modulation should include:

  • Temporal Expression Analysis

    • Measure ZDHHC4 mRNA and protein levels at multiple timepoints during pain induction and resolution

    • Compare with changes in substrate (e.g., TRPV1) levels and palmitoylation state

  • In Vitro Functional Studies

    • Co-expression studies in appropriate cell models (HEK293T, ND7/23 cells)

    • Palmitoylation assays (ABE)

    • Surface protein quantification

    • Electrophysiological recordings for channel function

  • In Vivo Models

    • Generate appropriate knockdown models (e.g., using shRNA)

    • Assess behavioral responses to pain stimuli (e.g., capsaicin injection)

    • Compare with depalmitoylase (e.g., APT1) knockdown models

  • Mechanistic Validation

    • Use palmitoylation inhibitors (e.g., 2-BP)

    • Employ catalytically inactive ZDHHC4 mutants

    • Test substrate mutants resistant to palmitoylation

How should ZDHHC4 expression data be analyzed in disease contexts?

Analysis of ZDHHC4 expression in disease contexts requires rigorous statistical approaches:

What challenges exist in interpreting ZDHHC4 functional data?

Interpreting ZDHHC4 functional data presents several challenges:

  • Substrate Specificity Overlap

    • Multiple ZDHHC family members may palmitoylate the same substrate, complicating interpretation of ZDHHC4-specific effects

    • Knockdown studies may show residual palmitoylation due to compensatory actions of other ZDHHCs

  • Dynamic Regulation

    • Palmitoylation is a reversible modification, with concurrent depalmitoylation by enzymes like APT1

    • Temporal dynamics must be considered when interpreting snapshot measurements

  • Context Dependency

    • ZDHHC4 function may vary across cell types, tissues, and disease states

    • Expression levels of both ZDHHC4 and its substrates influence observed effects

  • Technical Limitations

    • Palmitoylation assays have varying sensitivities and specificities

    • Overexpression systems may not recapitulate physiological regulation

How can researchers differentiate between direct and indirect effects of ZDHHC4?

Distinguishing direct from indirect effects requires multiple lines of evidence:

  • Direct Interaction Evidence

    • Co-immunoprecipitation demonstrating physical association

    • BiFC visualization of protein-protein interactions

    • Domain mapping to identify specific interaction regions

  • Enzymatic Activity Confirmation

    • In vitro palmitoylation assays with purified components

    • Use of catalytically inactive ZDHHC4 mutants as negative controls

    • Site-directed mutagenesis of substrate palmitoylation sites

  • Time-Course Studies

    • Rapid effects following ZDHHC4 expression/activation suggest direct mechanisms

    • Delayed responses may indicate secondary or downstream effects

  • Pathway Analysis

    • Inhibitor studies to block potential intermediate signaling pathways

    • Examine effects on known interactors and signaling nodes

What are promising therapeutic applications of ZDHHC4 research?

ZDHHC4 research offers several promising therapeutic avenues:

  • Pain Management

    • Development of ZDHHC4 activators could enhance TRPV1 palmitoylation and degradation, potentially reducing inflammatory pain

    • Targeting the ZDHHC4-APT1 balance could provide novel approaches for pain modulation

  • Cancer Therapeutics

    • Given ZDHHC4's upregulation in lung adenocarcinoma, inhibitors might have anti-tumor effects

    • ZDHHC4 could serve as a prognostic biomarker for patient stratification

  • Combination Therapies

    • ZDHHC4-targeting agents could potentially sensitize tumor cells to conventional treatments

    • Combining ZDHHC4 modulators with existing pain medications might improve efficacy or reduce side effects

What technological advances would accelerate ZDHHC4 research?

Several technological developments would significantly advance ZDHHC4 research:

  • Structural Biology Tools

    • Cryo-EM or X-ray crystallography of ZDHHC4 alone and in complex with substrates would provide insights for structure-based drug design

    • Molecular dynamics simulations to understand the palmitoylation mechanism

  • High-Throughput Screening Methods

    • Development of cell-based assays suitable for screening ZDHHC4 modulators

    • Fluorescence-based reporters for real-time monitoring of palmitoylation

  • Advanced Imaging Techniques

    • Super-resolution microscopy to visualize ZDHHC4-substrate interactions in native contexts

    • Live-cell imaging of palmitoylation dynamics

  • CRISPR-Based Technologies

    • CRISPR activation/interference systems for precise modulation of endogenous ZDHHC4 expression

    • Base editing for introducing specific mutations in ZDHHC4 or substrate palmitoylation sites

What are the key outstanding questions in ZDHHC4 biology?

Despite recent advances, several fundamental questions about ZDHHC4 remain unanswered:

  • Substrate Selectivity Mechanisms

    • How does ZDHHC4 recognize its specific substrates among the thousands of cellular proteins?

    • What structural features determine ZDHHC4's preference for certain cysteine residues?

  • Regulatory Networks

    • What signaling pathways and transcription factors control ZDHHC4 expression in different contexts?

    • How is ZDHHC4 enzymatic activity regulated post-translationally?

  • Evolutionary Conservation

    • How conserved are ZDHHC4 functions across species, particularly between bovine and human systems?

    • What evolutionary pressures have shaped ZDHHC4 substrate specificity?

  • Broader Physiological Roles

    • Beyond pain modulation and potential cancer involvement, what other physiological processes require ZDHHC4 function?

    • How does ZDHHC4 contribute to normal cellular homeostasis?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.