Recombinant Bovine Prokineticin receptor 1 (PROKR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Prokineticin Receptor 1

Prokineticin receptor 1 (PROKR1) is a G-protein-coupled receptor that mediates the biological effects of prokineticins, a family of secreted proteins involved in multiple physiological processes. PROKR1 is also known by several synonyms including PKR-1, GPR73, GPR-73a, ZAQ, PK-R1, G Protein-Coupled Receptor 73, and G-protein coupled receptor ZAQ . This receptor plays a crucial role in mediating the effects of prokineticins, which are involved in a wide range of physiological and pathological conditions . The signaling through PROKR1 influences reproductive functions, circadian rhythms, and pain perception, making it an important focus of research in multiple fields .

PROKR1 belongs to the family of G-protein-coupled receptors, which are characterized by their seven-transmembrane domain structure and their ability to transduce extracellular signals into intracellular responses. The activation of PROKR1 by its ligands, including prokineticin 1 (PROK1) and prokineticin 2 (PROK2), triggers various downstream signaling pathways that regulate cellular functions. These signaling cascades have significant implications for multiple biological processes, including angiogenesis, immune response, and cellular proliferation .

Understanding the structure, function, and signaling mechanisms of PROKR1 is essential for elucidating its role in normal physiology and pathological conditions. Recent advances in recombinant protein technology have facilitated the production of recombinant bovine PROKR1, enabling detailed investigations of this receptor's properties and functions. These studies have provided valuable insights into the role of PROKR1 in various biological contexts, particularly in reproductive biology and early pregnancy .

Protein Structure and Features

Bovine PROKR1 is a complex integral membrane protein with a characteristic G-protein-coupled receptor structure. The bovine PROKR1 protein is identified in the UniProt database with the accession number Q8SPN2 . Like other G-protein-coupled receptors, PROKR1 features seven transmembrane domains that anchor the protein within the cell membrane. The extracellular domains are involved in ligand binding, while the intracellular domains interact with G-proteins and other signaling molecules to initiate intracellular signaling cascades. The structural features of PROKR1 are essential for its function in transmitting signals from the extracellular environment to the intracellular machinery.

Recombinant Production of Bovine PROKR1

Recombinant bovine PROKR1 protein is typically produced in prokaryotic expression systems, with Escherichia coli (E. coli) being a common host organism . The recombinant protein is often tagged with a histidine (His) tag at the N-terminus to facilitate purification and detection . The production of recombinant PROKR1 involves cloning the PROKR1 gene into an expression vector, transforming the vector into the host organism, inducing protein expression, and purifying the protein using affinity chromatography. The purified recombinant protein typically has a purity of greater than 97% as determined by SDS-PAGE and other analytical methods .

Recombinant PROKR1 proteins serve as valuable tools for studying the receptor's structure, function, and interactions with its ligands and downstream signaling molecules. They can be used in various applications including structural studies, binding assays, and the development of screening systems for potential modulators of PROKR1 signaling. The availability of high-quality recombinant PROKR1 has significantly advanced our understanding of this important receptor and its role in various biological processes.

Tissue-Specific Expression Patterns

PROKR1 exhibits a wide distribution across various tissues, with particularly high expression in peripheral tissues. The receptor is abundantly expressed in the gastrointestinal system, lungs, blood leukocytes, spleen, pancreas, testes, salivary gland, and endocrine glands . This broad distribution pattern reflects the diverse physiological roles of PROKR1 in different organ systems. The expression of PROKR1 in the gastrointestinal system is particularly significant, as it indicates a major role in mediating and regulating gastrointestinal motility . The receptor's expression in reproductive tissues, including the testes and endocrine glands, correlates with its important functions in reproductive biology.

In the context of reproductive physiology, PROKR1 expression has been extensively studied in the corpus luteum and endometrium. Research has shown that PROKR1 expression fluctuates during different physiological states, particularly during the estrous cycle and pregnancy. For instance, studies in porcine models have demonstrated that PROKR1 mRNA abundance increases on Days 12 and 14 of pregnancy in the corpus luteum . This temporal regulation suggests a role for PROKR1 in maintaining luteal function during early pregnancy.

Expression During Pregnancy

During early pregnancy, PROKR1 expression is elevated in the decidua compared to non-pregnant endometrium . Immunohistochemical analyses have localized PROKR1 expression to specific cell types within the decidua, including glandular epithelium and endothelial cells of the microvasculature . This pattern of expression suggests a role for PROKR1 in regulating endometrial function during implantation and early placentation. The coordinated expression of PROKR1 and its ligand PROK1 in the decidua indicates a paracrine signaling mechanism that may be important for establishing and maintaining pregnancy.

The expression of PROKR1 in endothelial cells is particularly noteworthy, as it suggests a role in regulating angiogenesis, a critical process for placental development and function. Studies have demonstrated that PROK1-PROKR1 signaling stimulates angiogenesis by increasing capillary-like structure formation by luteal endothelial cells and elevating angiogenin gene expression and VEGFA secretion . This angiogenic function of PROKR1 may be essential for the vascular remodeling that occurs during placentation and for maintaining adequate blood flow to the developing placenta.

PROK1-PROKR1 Signaling Cascade

The binding of PROK1 to PROKR1 initiates a complex signaling cascade that involves multiple intracellular pathways. In endometrial epithelial cells, PROK1 binding to PROKR1 results in inositol phosphate production and phosphorylation of several key signaling molecules, including cSrc, epidermal growth factor receptor (EGFR), and ERK1/2 . These signaling events are part of the Gq-phospholipase C (PLC) pathway, which is a primary signaling mechanism activated by PROKR1. The activation of this pathway leads to calcium mobilization and the activation of protein kinase C, which in turn regulates various cellular responses.

In addition to the Gq-PLC pathway, PROK1-PROKR1 signaling also activates the MAPK pathway, as evidenced by the phosphorylation of MAPK and PTK2 in response to PROK1 stimulation . This pathway is involved in regulating gene expression, cell proliferation, and cell survival. The activation of these multiple signaling pathways by PROK1-PROKR1 signaling underscores the complex and diverse effects of this signaling system on cellular function.

Regulation of Gene Expression

PROK1-PROKR1 signaling regulates the expression of numerous genes involved in various biological processes. Gene microarray analysis has identified 49 genes that are differentially regulated in response to PROK1 stimulation of PROKR1-expressing cells . Many of these genes, including cyclooxygenase (COX)-2, leukemia inhibitory factor, IL-6, IL-8, and IL-11, are known to be regulated in the endometrium during implantation and early pregnancy . The upregulation of these genes by PROK1-PROKR1 signaling suggests a role in preparing the endometrium for implantation and supporting early embryonic development.

The regulation of COX-2 expression by PROK1-PROKR1 signaling is particularly significant, as COX-2 is a key enzyme in prostaglandin synthesis. Studies have demonstrated that PROK1 treatment increases COX-2 mRNA and protein expression, as well as prostaglandin synthesis, in first-trimester decidua . This effect is dependent on the activation of the Gq-PLC pathway, highlighting the importance of this signaling pathway in mediating the effects of PROK1-PROKR1 signaling on gene expression. The induction of prostaglandin synthesis by PROK1-PROKR1 signaling may contribute to the regulation of uterine contractility and vascular function during pregnancy.

Role in Corpus Luteum Function

The corpus luteum is a temporary endocrine structure that forms from the follicle after ovulation and plays a crucial role in reproductive physiology by secreting progesterone, a hormone essential for establishing and maintaining pregnancy. Research has demonstrated that PROK1-PROKR1 signaling regulates several processes vital for corpus luteum function, including steroidogenesis, luteal cell apoptosis and viability, and angiogenesis . PROK1, acting via PROKR1, stimulates the expression of genes involved in progesterone synthesis and increases progesterone secretion by luteal tissue . This steroidogenic function is essential for maintaining adequate progesterone levels during early pregnancy.

PROK1-PROKR1 signaling also influences luteal cell survival and function. Studies have shown that this signaling pathway reduces apoptosis and increases the viability of luteal cells . By promoting luteal cell survival, PROK1-PROKR1 signaling helps maintain the structural and functional integrity of the corpus luteum, which is essential for sustained progesterone production. The anti-apoptotic effect of PROK1-PROKR1 signaling may be particularly important during early pregnancy when the corpus luteum needs to be maintained beyond its typical lifespan in non-pregnant cycles.

Role in Implantation and Placentation

PROKR1 plays significant roles in the processes of implantation and placentation, which are critical for successful pregnancy establishment. PROK1-PROKR1 signaling in trophoblasts induces the expression of genes involved in angiogenesis, immunological response, cell adhesion, invasion, and proliferation . These processes are essential for the proper development and function of the placenta, which is responsible for nutrient and gas exchange between the maternal and fetal circulations. The regulation of angiogenesis by PROK1-PROKR1 signaling is particularly important for establishing the vascular network of the placenta.

PROK1-PROKR1 signaling also promotes trophoblast cell proliferation and adhesion, which are crucial for implantation and placental development . The stimulation of cell proliferation by PROK1 is mediated by several signaling pathways, including PI3K/AKT/mTOR, MAPK, and cAMP, while cell adhesion is mediated by MAPK and/or PI3K/AKT signaling pathways . These cellular processes contribute to the invasion of the trophoblast into the maternal endometrium and the establishment of the maternal-fetal interface. The pleiotropic effects of PROK1-PROKR1 signaling on trophoblast function highlight its importance in the complex process of placentation.

Production Methods and Characterization

Recombinant bovine PROKR1 is primarily produced in bacterial expression systems, with E. coli being the most commonly used host organism . The protein is typically expressed with a histidine (His) tag to facilitate purification using affinity chromatography techniques . The purified recombinant protein undergoes extensive quality control measures to ensure high purity and functionality. Analytical techniques such as SDS-PAGE, Western blotting, and mass spectrometry are employed to verify the identity, purity, and integrity of the recombinant protein. The purity of commercially available recombinant bovine PROKR1 is reported to be greater than 97%, indicating a high-quality product suitable for various research applications .

The characterization of recombinant PROKR1 also includes functional assays to confirm that the protein retains its native binding and signaling properties. These assays may include ligand binding studies, G-protein activation assays, and downstream signaling pathway analyses. The successful production of functionally active recombinant PROKR1 provides researchers with a valuable tool for studying the receptor's properties and for developing screening systems for potential modulators of PROKR1 signaling.

Research Applications of Recombinant PROKR1

Recombinant bovine PROKR1 has multiple applications in research and diagnostics. It can be used as a standard in quantitative assays for PROKR1, as an immunogen for antibody production, and as a positive control in Western blotting and other immunoassays . The availability of high-quality recombinant PROKR1 enables researchers to develop and validate specific and sensitive detection methods for this receptor, which is essential for studying its expression and function in various biological contexts.

In addition to its use as a reagent in analytical techniques, recombinant PROKR1 also serves as a valuable tool for studying the receptor's structure, ligand binding properties, and signaling mechanisms. Structural studies using recombinant PROKR1 can provide insights into the receptor's three-dimensional architecture and the molecular basis of its interactions with ligands and signaling molecules. Binding assays with recombinant PROKR1 can be used to screen for and characterize potential agonists or antagonists of the receptor, which may have therapeutic applications in conditions involving dysregulated PROKR1 signaling.

ApplicationDescriptionReference
SDS-PAGEAnalysis of protein purity and molecular weight
Western BlottingDetection and quantification of PROKR1
ImmunogenProduction of antibodies against PROKR1
Positive ControlStandard for assay validation
Structural StudiesInvestigation of protein conformation and domain organization
Binding AssaysCharacterization of ligand-receptor interactions

ELISA-Based Detection Systems

Enzyme-linked immunosorbent assay (ELISA) is a widely used technique for the detection and quantification of PROKR1 in biological samples. The Bovine Prokineticin Receptor 1 (PKR1) ELISA Kit (BODL00140) is a commercially available sandwich ELISA designed for the precise measurement of PKR1 levels in bovine samples . This kit offers exceptional sensitivity (0.23 ng/mL) and a detection range of 0.937-60 ng/mL, ensuring accurate and consistent results for various research applications . The sandwich ELISA format, which uses two antibodies that bind to different epitopes of PROKR1, provides high specificity and sensitivity for detecting the receptor in complex biological matrices.

The ELISA kit can be used with various sample types, including serum, plasma, tissue homogenates, cell lysates, cell culture supernatants, and other biological fluids . This versatility makes it a valuable tool for studying PROKR1 expression and regulation in different biological contexts. The quantification of PROKR1 levels using ELISA enables researchers to investigate changes in receptor expression under various physiological and pathological conditions, providing insights into the role of PROKR1 in normal function and disease.

Product NameBovine Prokineticin Receptor 1 (PKR1) ELISA Kit
Product CodeBODL00140
Size96 Assays
TargetPKR1
SynonymsPROKR1, PKR-1, GPR73, GPR-73a, ZAQ, PK-R1, G Protein-Coupled Receptor 73, G-protein coupled receptor ZAQ
Detection MethodSandwich
Range0.937-60 ng/mL
Sensitivity0.23 ng/mL
Sample TypesSerum, Plasma, Tissue Homogenates, Cell Lysates, Cell Culture Supernatants, Other Biological Fluids
Shelf Life12 months

Immunohistochemistry and Cellular Localization

Immunohistochemistry is a powerful technique for localizing PROKR1 expression in tissues and determining its cellular distribution. Studies have used immunohistochemistry to visualize PROKR1 expression in various tissues, including the endometrium and corpus luteum . For instance, immunohistochemical analyses have localized PROKR1 expression to glandular epithelium and endothelial cells of the microvasculature in first-trimester decidua . This cellular localization provides valuable information about the potential functions of PROKR1 in specific cell types and tissues.

Dual-immunofluorescence histochemistry has been employed to investigate the co-localization of PROKR1 with other proteins, such as COX-2 and CD31 (an endothelial cell marker) . This approach enables researchers to determine whether PROKR1 is expressed in specific cell types and whether it co-localizes with proteins involved in relevant signaling pathways or cellular functions. The co-expression of PROKR1 with COX-2, for example, supports the functional link between PROKR1 signaling and prostaglandin synthesis, while co-localization with CD31 confirms the expression of PROKR1 in endothelial cells, consistent with its role in angiogenesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes for us to prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PROKR1; GPR73; PKR1; Prokineticin receptor 1; PK-R1; G-protein coupled receptor 73; G-protein coupled receptor ZAQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-393
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MEITMGVMDENATNTSTNYFPLLDPLGAQAASFPFNFSYGDYDMPLDEDEDMTNSRTFFA AKIVIGMALVGIMLVCGIGNFIFIAALARYKKLRNLTNLLIANLAISDFLVAIVCCPFEM DYYVVRQLSWEHGHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKYQTAT GLIALVWVVSILVAIPSAYFTTETVLVIVKSQEKIFCGQIWPVDQQIYYKSYFLFIFGIE FVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCILTAYVLCWAPF YGFAIVRDFFPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTIKYFKKIMLLH WKASYNGSKSSGDLDLKTTGVPATEEVDCIGLK
Uniprot No.

Target Background

Function
Prokineticin receptor 1 (PROKR1) is a receptor for prokineticin 1. It is exclusively coupled to the G(q) subclass of heteromeric G proteins. Activation triggers mobilization of calcium, stimulation of phosphoinositide turnover, and activation of p44/p42 mitogen-activated protein kinase. PROKR1 may play a role during early pregnancy.
Gene References Into Functions
  1. PROK1, acting through PROKR1, may be involved in the recruitment and activation of monocytes to regressing corpus luteum and atretic follicles. PMID: 17229935
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Bovine PROKR1 and what are its key characteristics?

Bovine Prokineticin Receptor 1 (PROKR1) is a G protein-coupled receptor that shares approximately 85% amino acid identity with PROKR2. This receptor is also known by several synonyms including PKR1, GPR73, GPR-73a, ZAQ, and PK-R1. PROKR1 functions primarily by binding prokineticins (particularly PROK1) to regulate various biological processes. The receptor is widely expressed in peripheral tissues, with particularly high expression in the gastrointestinal system, lungs, and blood system . PROKR1 has a higher binding affinity for PROK1 compared to PROKR2, which can influence downstream signaling specificity in different tissue contexts .

What signaling pathways are activated by PROKR1?

PROKR1 activates multiple signaling cascades upon ligand binding. The primary pathways include:

  • Calcium mobilization

  • Phosphoinositol turnover

  • Activation of Akt kinase

  • Mitogen-activated protein kinase (MAPK) pathway

While calcium mobilization is dependent on Gq proteins, the activation of MAPK pathways demonstrates sensitivity to pertussis toxin, suggesting that PROKR1 also couples to Gi proteins . In certain tissues like dorsal root ganglion neurons, PROKR1 activates transient receptor potential vanilloid 1 (TRPV1) channels through a pathway likely involving protein kinase C activation . This complex signaling network allows PROKR1 to mediate diverse cellular responses in different tissues.

What is the tissue distribution pattern of PROKR1 in bovine systems?

PROKR1 displays a distinctive tissue distribution pattern that differs from PROKR2. While PROKR2 is predominantly expressed in the central nervous system (particularly in the hypothalamus, olfactory ventricular regions, and limbic system), PROKR1 is more abundant in peripheral tissues . In the gastrointestinal system, PROKR1 is more abundantly expressed in the intestine compared to PROKR2, suggesting it may be the primary receptor mediating prokineticin effects on gastrointestinal motility. Additionally, PROKR1 expression has been detected in various endocrine tissues including thyroid, pituitary, adrenal gland, testis, and ovary , indicating its potential roles in hormone regulation.

How does PROK1-PROKR1 signaling affect corpus luteum function during different reproductive states?

PROK1-PROKR1 signaling demonstrates differential effects on corpus luteum (CL) function depending on the reproductive state. Research in porcine models has revealed significant impacts on steroidogenesis, cell survival, and angiogenesis. During early pregnancy (Day 12), PROK1 significantly upregulates the expression of steroidogenic genes including STAR and HSD3B1 (p<0.0001) in luteal explants, while also elevating CYP11A1 expression (p<0.05) . Interestingly, the same signaling pathway shows opposite effects on CYP11A1 expression during the estrous cycle, where PROK1 reduces CYP11A1 expression in CL explants collected on Day 12 (p<0.05) .

The effects on progesterone production also vary by reproductive state. PROK1 elevates progesterone concentration in:

  • Day 12 of pregnancy (p<0.05)

  • Day 14 of the estrous cycle (p<0.05)

  • Day 14 of pregnancy (p<0.05)

These differential effects suggest that PROK1-PROKR1 signaling is modulated by the hormonal environment and may play distinct roles in CL maintenance during pregnancy versus the estrous cycle.

What is the relationship between PROKR1 activation and angiogenesis in reproductive tissues?

PROKR1 activation by PROK1 has significant pro-angiogenic effects in reproductive tissues, particularly in the corpus luteum. When PROK1 acts through PROKR1, it stimulates several key angiogenic processes:

  • Increased formation of capillary-like structures by luteal endothelial cells

  • Elevated expression of angiogenin genes

  • Enhanced secretion of Vascular Endothelial Growth Factor A (VEGFA) by luteal tissue

The capillary-like structure formation assay using primary luteal endothelial cells isolated from corpus luteum on Day 12 of the estrous cycle demonstrated that PROK1 increases the numbers of nodes and junctions in the endothelial network . This suggests that PROKR1 activation promotes the reorganization of endothelial cells into vessel-like structures.

This angiogenic effect appears particularly important during the mid-luteal phase and early pregnancy, potentially contributing to the extended lifespan of the corpus luteum during pregnancy. The differential regulation of angiogenesis may be a key mechanism by which PROKR1 signaling supports the distinct vascular requirements of the corpus luteum in different reproductive states.

What are the optimal methods for quantifying recombinant Bovine PROKR1 expression?

For accurate quantification of recombinant Bovine PROKR1 expression, several complementary approaches should be employed:

  • ELISA-based detection: Sandwich ELISA kits designed specifically for Bovine PROKR1 offer reliable quantification with a sensitivity of approximately 0.23ng/mL and a detection range of 0.937-60ng/mL . These assays are particularly useful for detecting PROKR1 in serum, plasma, tissue homogenates, cell lysates, and cell culture supernatants.

  • Quantitative RT-PCR: For mRNA expression analysis, qRT-PCR provides high sensitivity. When designing primers, researchers should account for the various synonyms and potential splice variants of PROKR1 (including PKR-1, GPR73, ZAQ) to ensure specific amplification.

  • Immunological detection methods: Western blotting and immunohistochemistry/immunofluorescence using validated antibodies allow for protein-level detection and localization studies. When using immunofluorescence, it is essential to include appropriate controls, such as normal IgG negative controls, to confirm antibody specificity .

  • Radioligand binding assays: For functional studies of the receptor, radioligand binding assays using labeled prokineticins can determine receptor density and binding affinity.

For optimal results, researchers should validate their detection methods using positive controls (tissues known to express high levels of PROKR1, such as intestinal samples) and negative controls (tissues or cell lines with minimal PROKR1 expression).

How can researchers effectively design experiments to study PROKR1-mediated signaling in corpus luteum?

Designing effective experiments to study PROKR1-mediated signaling in corpus luteum requires a multi-faceted approach:

  • Tissue collection timing: Given the dynamic expression of PROKR1 during different reproductive states, precise timing of tissue collection is crucial. For porcine models, days 10-14 of the estrous cycle and corresponding days of pregnancy are particularly informative for comparative studies .

  • Ex vivo tissue culture systems: Precision-cut luteal slice in vitro models allow for controlled experimental manipulation while maintaining tissue architecture. These systems are particularly useful for studying the effects of PROK1 on gene expression and hormone production .

  • Cell isolation and characterization: Isolation of primary luteal cells and luteal endothelial cells should be followed by thorough characterization. For luteal cells, confirmation of steroidogenic markers like HSD3B1 is essential. For endothelial cells, markers such as von Willebrand factor (vWF) should be confirmed .

  • Functional assays:

    • Steroidogenesis: Measure gene expression of key enzymes (STAR, HSD3B1, CYP11A1) and progesterone production

    • Cell viability/apoptosis: FITC-Annexin V and propidium iodide staining

    • Angiogenesis: Capillary-like structure formation assays with primary luteal endothelial cells

  • Receptor specificity controls: Include experiments with specific PROKR1 antagonists or siRNA-mediated knockdown to confirm receptor specificity of observed effects.

A comprehensive experimental design should incorporate time-course studies to capture the dynamic nature of PROKR1 signaling and dose-response analyses to characterize the sensitivity of different downstream pathways.

What analytical techniques are most effective for studying PROKR1-PROK1 binding interactions?

Studying PROKR1-PROK1 binding interactions requires specialized analytical techniques that can provide insights into binding affinity, kinetics, and structural determinants:

  • Surface Plasmon Resonance (SPR): This label-free technique can determine association and dissociation rates (kon and koff) as well as equilibrium dissociation constants (KD) for PROK1-PROKR1 interactions. Recombinant PROKR1 can be immobilized on a sensor chip, and varying concentrations of PROK1 can be flowed over the surface.

  • Isothermal Titration Calorimetry (ITC): ITC provides thermodynamic parameters of binding, including binding stoichiometry, enthalpy changes, and binding constants.

  • Fluorescence-based binding assays: Using fluorescently labeled PROK1 or employing fluorescence resonance energy transfer (FRET) techniques can provide insights into binding dynamics in real-time.

  • Radioligand binding assays: Classical competitive binding assays using radiolabeled ligands can determine binding affinities and receptor densities in various tissue preparations.

  • Bioluminescence Resonance Energy Transfer (BRET): For studying PROKR1 interactions with downstream signaling molecules, BRET can be employed to monitor protein-protein interactions in living cells.

When conducting these analyses, it's important to consider that PROK1 has differential binding affinities for PROKR1 and PROKR2, with a higher affinity for PROKR1 . Therefore, comparative binding studies with both receptors can provide valuable insights into ligand selectivity determinants.

How should researchers interpret contradictory results in PROKR1 signaling studies?

Contradictory results in PROKR1 signaling studies are not uncommon and require careful interpretation. Several factors may contribute to seemingly conflicting findings:

  • Reproductive state differences: PROKR1 signaling shows distinct effects depending on reproductive state. For example, PROK1 elevates CYP11A1 expression in corpus luteum during pregnancy but reduces it during the estrous cycle . Researchers should explicitly consider and compare reproductive states when interpreting results.

  • Cell type-specific responses: PROKR1 can couple to different G proteins (Gq, Gi, Gs) depending on the cellular context , potentially leading to different signaling outcomes. Experiments should clearly identify the cell types being studied and avoid generalizing findings across different cell populations.

  • Downstream pathway interactions: The complex interactions between different signaling pathways activated by PROKR1 may lead to context-dependent outcomes. Pathway-specific inhibitors can help dissect these interactions and resolve apparent contradictions.

  • Species differences: Substantial variation in PROKR1 function exists across species. Research in porcine models shows PROK1-PROKR1 signaling is important during early pregnancy, while in bovine systems, strong expression occurs during luteal regression . Cross-species comparisons should acknowledge these differences.

  • Methodological variations: Differences in experimental approaches, including ligand concentrations, exposure times, and assay readouts, can contribute to discrepant findings. Standardized protocols and comprehensive reporting of methods can help address this issue.

When confronted with contradictory results, researchers should consider these factors and design experiments that systematically explore the contextual determinants of PROKR1 signaling outcomes rather than viewing contradictions as experimental failures.

What are the key considerations when analyzing PROKR1 function in complex tissue environments?

Analyzing PROKR1 function in complex tissue environments presents unique challenges that require specific considerations:

  • Cellular heterogeneity: Tissues like the corpus luteum contain multiple cell types (steroidogenic cells, endothelial cells, immune cells) that may respond differently to PROKR1 activation. Single-cell approaches or cell-specific isolation techniques should be employed to deconvolute cell type-specific responses.

  • Paracrine interactions: PROKR1 activation may trigger the release of secondary mediators that act on neighboring cells. For example, PROK1 stimulates VEGFA secretion by luteal tissue , which can then influence surrounding cells. Analyzing both direct and indirect effects is essential for a comprehensive understanding of PROKR1 function.

  • Temporal dynamics: PROKR1 expression and signaling effects vary throughout physiological processes like the estrous cycle. Time-course studies with appropriately spaced sampling points are necessary to capture these dynamics.

  • Compensatory mechanisms: In complex tissues, inhibition or activation of PROKR1 may trigger compensatory responses through parallel signaling pathways. Combined interventions targeting multiple pathways may be needed to fully understand PROKR1's role.

  • Ex vivo versus in vivo discrepancies: Findings from isolated cells or ex vivo tissue cultures may not fully recapitulate in vivo functions due to missing systemic factors. Validation using in vivo models with tissue-specific manipulations provides the most comprehensive insights.

Researchers should employ complementary approaches that bridge the gap between reductionist cell culture systems and complex in vivo environments, such as precision-cut tissue slices or organoid cultures that maintain tissue architecture while allowing experimental manipulation.

How reliable are current animal models for studying bovine PROKR1 function?

The reliability of animal models for studying bovine PROKR1 function varies based on several factors:

For optimal reliability, researchers should employ bovine-derived experimental systems whenever possible and validate findings across multiple experimental approaches. When using non-bovine models, careful consideration of species differences is essential for appropriate interpretation of results.

What are the emerging technologies that could advance PROKR1 research?

Several emerging technologies hold promise for advancing our understanding of PROKR1 biology:

  • CRISPR-Cas9 gene editing: This technology enables precise modification of PROKR1 in primary bovine cells or even embryos, allowing for the creation of knockout or knock-in models to study receptor function. CRISPR-based approaches can also be used for high-throughput screening of PROKR1 regulatory elements.

  • Single-cell multi-omics: Integrating single-cell RNA sequencing with proteomics and epigenomics can reveal cell type-specific PROKR1 expression patterns and signaling responses within heterogeneous tissues like the corpus luteum.

  • Advanced tissue culture systems: Microfluidic organ-on-chip platforms and 3D organoid cultures can provide more physiologically relevant models for studying PROKR1 function while maintaining the complex cellular interactions present in vivo.

  • Spatial transcriptomics and proteomics: These techniques allow for the visualization of PROKR1 expression and downstream signaling events with spatial resolution in intact tissues, providing insights into local signaling microenvironments.

  • Optogenetic and chemogenetic approaches: These tools enable temporal control over PROKR1 activation, allowing researchers to study the dynamics of signaling with unprecedented precision.

  • Cryo-electron microscopy: Structural studies of PROKR1 using cryo-EM could reveal the molecular determinants of ligand binding and receptor activation, potentially informing the development of selective modulators.

These technologies, particularly when used in combination, have the potential to overcome current limitations in PROKR1 research and provide more comprehensive insights into its functions in different physiological and pathological contexts.

What unresolved questions about PROKR1 warrant further investigation?

Despite significant advances in our understanding of PROKR1 biology, several important questions remain unresolved:

  • Ligand selectivity mechanisms: Although PROK1 has higher affinity for PROKR1 than PROKR2 , the structural determinants of this selectivity are not fully understood. Detailed structural studies could reveal the molecular basis of ligand recognition and inform the development of receptor-selective compounds.

  • Signaling pathway integration: PROKR1 activates multiple signaling pathways, including calcium mobilization, MAPK, and Akt , but how these pathways integrate to produce cell type-specific responses remains unclear. Systematic analysis of pathway crosstalk could provide insights into the context-dependent effects of PROKR1 activation.

  • Reproductive state-dependent functions: The differential effects of PROKR1 signaling during pregnancy versus the estrous cycle suggest complex regulatory mechanisms that are not fully characterized. Identifying the factors that modulate PROKR1 signaling in different reproductive states could reveal new aspects of luteal function regulation.

  • Therapeutic potential: The role of PROKR1 in processes like angiogenesis, steroidogenesis, and pain perception suggests potential therapeutic applications, but translational research in this area remains limited. Developing selective PROKR1 modulators and testing their effects in relevant disease models could reveal novel therapeutic strategies.

  • Evolutionary conservation and divergence: Comparative studies across species could reveal conserved core functions of PROKR1 versus species-specific adaptations, providing insights into the evolutionary history and biological significance of this signaling pathway.

Addressing these questions will require interdisciplinary approaches combining molecular biology, structural biology, systems biology, and translational research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.