Prokineticin receptor 2 is an integral membrane protein that functions as a G protein-coupled receptor for prokineticins, a family of secreted proteins with diverse biological activities. Prokineticins promote angiogenesis and induce strong gastrointestinal smooth muscle contraction, indicating their importance in multiple physiological systems . The receptor is known by several alternative designations including GPR73L1, GPR73b, PKR2, and KAL3, reflecting its discovery context and functional relationships with other proteins .
The prokineticin signaling system consists of two main ligands (prokineticin 1 and prokineticin 2) and two receptors (prokineticin receptor 1 and prokineticin receptor 2). This signaling pathway participates in critical biological processes including inflammation regulation, circadian rhythm maintenance, and neuronal migration during development . The receptor's conservation across multiple species, including humans, rodents, and bovines, underscores its fundamental biological importance.
Prokineticin receptor 2 has gained significant research attention due to its involvement in several pathological conditions, including Kallmann syndrome and normosmic idiopathic hypogonadotropic hypogonadism, conditions characterized by impaired development of reproductive systems and, in some cases, olfactory function . The receptor's presence across numerous tissue types further highlights its multifaceted physiological roles.
The complete amino acid sequence of bovine prokineticin receptor 2 has been characterized and is available through protein databases. The sequence begins with "MAAQNGNASFPANFSIPQEHASSLPFNFSYDDYDLPLDEDEDMTKTQTFFAAKIVIGVAL" and continues through 384 amino acids . This primary structure determines the protein's folding pattern, membrane integration, and functional interactions with ligands and intracellular signaling molecules.
Prokineticin receptor 2 plays a crucial role in the development of the olfactory system and migration of gonadotropin-releasing hormone (GnRH) neurons. Studies have demonstrated that the PROK2-PROKR2 signaling pathway is essential for olfactory bulb formation and proper positioning of GnRH neurons, which regulate reproductive function . The receptor functions as part of a chemoattractant system, guiding neuronal progenitors and migrating neurons during embryonic development.
Research has shown that Prokineticin receptor 2 and GnRH are expressed in proximity within the vomeronasal organ and along the GnRH migratory route during embryological development . This spatial relationship supports the hypothesis that prokineticin 2, expressed in the developing olfactory bulb, acts as a chemoattractant for olfactory guiding fibers and GnRH neurons, directing their migration to appropriate locations.
The critical role of prokineticin receptor 2 in reproductive system development has been established through genetic studies. Loss-of-function mutations in the PROKR2 gene have been associated with Kallmann syndrome and normosmic idiopathic hypogonadotropic hypogonadism, conditions characterized by delayed or absent puberty and infertility . These findings highlight the receptor's importance in establishing the neuroendocrine circuits that control reproductive function.
Emerging evidence suggests that prokineticin receptor 2 participates in regulating inflammatory processes. Studies examining rheumatoid arthritis and osteoarthritis have found differential expression of prokineticin receptor 1 and prokineticin receptor 2 in affected tissues . In particular, prokineticin receptor 1 expression was found to be downregulated in rheumatoid arthritis synovial tissue compared to osteoarthritis synovial tissue, suggesting altered signaling through these receptors may contribute to chronic inflammation .
Recombinant bovine prokineticin receptor 2 is typically produced using prokaryotic expression systems, particularly Escherichia coli . This approach enables large-scale production of the protein for research and experimental applications. The recombinant protein usually incorporates modifications such as histidine tags to facilitate purification through affinity chromatography methods.
Recombinant bovine prokineticin receptor 2 serves as a valuable tool for investigating the prokineticin signaling system. Applications include structure-function relationship studies, ligand binding assays, antibody production and validation, and comparative analyses across species. The availability of purified recombinant protein facilitates detailed biochemical and biophysical characterization that would be challenging with native protein from tissue sources.
The protein can be utilized in various experimental techniques including:
SDS-PAGE analysis for protein characterization
Western blotting for expression studies
Immunoprecipitation for protein interaction studies
Ligand binding assays to assess receptor-ligand interactions
Cell-based assays for functional studies
Bovine prokineticin receptor 2 offers a model system for comparative studies with the human receptor. Such comparisons can provide insights into evolutionarily conserved features that are likely essential for function, as well as species-specific differences that may influence ligand binding specificity or signaling efficacy. These comparative approaches contribute to understanding the fundamental biology of prokineticin signaling and its diverse roles across species.
Recent research has expanded our understanding of prokineticin receptor 2's roles beyond reproductive and olfactory systems. Studies have implicated the prokineticin signaling pathway in inflammation regulation, suggesting potential therapeutic targets for inflammatory conditions . The finding that prokineticin 2 concentrations are higher in rheumatoid arthritis synovial fluid compared to osteoarthritis synovial fluid indicates differential involvement in various inflammatory conditions .
Additionally, research has revealed complex interactions between prokineticin receptor 2 signaling and other physiological systems, including circadian rhythm regulation and modulation of inflammatory responses . These findings open new avenues for investigating the receptor's diverse biological functions and potential therapeutic applications.
Several promising research directions for prokineticin receptor 2 include:
Development of selective agonists and antagonists for the receptor
Investigation of receptor-specific signaling pathways in various cell types
Exploration of potential therapeutic applications in reproductive disorders
Further characterization of its role in inflammatory conditions
Examination of species-specific variations in receptor function and regulation
Future studies may benefit from advanced technologies such as cryo-electron microscopy to determine the three-dimensional structure of the receptor, CRISPR-Cas9 gene editing to investigate function in cellular and animal models, and high-throughput screening approaches to identify novel ligands and modulators.
Receptor for prokineticin 2. It exclusively couples to the Gq subclass of heterotrimeric G proteins. Activation results in calcium mobilization, stimulation of phosphoinositide turnover, and activation of p44/p42 mitogen-activated protein kinase.
PROKR2 is a G protein-coupled receptor (GPCR) that serves as the cognate receptor for prokineticin 2 (PROK2). The receptor features a seven-transmembrane domain structure characteristic of GPCRs, with particularly conserved regions in transmembrane domains 4 and 6. Wild-type PROKR2 typically presents in multiple glycosylation states when assessed via immunoblotting, with fully mature (fully glycosylated) forms appearing as diffuse bands of approximately 55-70 kDa, while immature forms present as smaller, more distinct bands below 50 kDa .
The prokineticin signaling system functions through PROK2 binding to PROKR2, triggering multiple downstream pathways including MAPK activity and intracellular calcium mobilization. These signaling cascades mediate PROKR2's diverse physiological roles in reproduction, circadian rhythm regulation, metabolism, neurogenesis, and inflammatory responses . In the reproductive system specifically, PROKR2 plays a critical role in GnRH neuronal migration and potentially in GnRH secretion, making it essential for normal reproductive development and function .
Post-translational modifications, particularly glycosylation, are crucial for proper PROKR2 trafficking and function. When analyzing wild-type PROKR2 via immunoblotting, multiple distinctive bands can be observed representing differently glycosylated states of the receptor . The mature, fully glycosylated form (55-70 kDa) represents functional PROKR2 that has successfully trafficked to the cell surface, while smaller bands represent immature forms retained within intracellular compartments .
Proper glycosylation is essential for cell surface expression and ligand binding capacity. Studies using stable cell lines expressing wild-type PROKR2 have demonstrated that only properly glycosylated forms reach the plasma membrane and respond appropriately to PROK2 stimulation, as confirmed by calcium mobilization assays . When glycosylation is impaired, either through mutation or pharmacological intervention, PROKR2 fails to reach the cell surface and loses its signaling capabilities. This indicates that monitoring glycosylation states provides valuable information about the functional status of recombinant bovine PROKR2 in experimental systems.
Mammalian expression systems, particularly HEK293T cells, have proven effective for generating functional recombinant PROKR2. These systems provide the appropriate cellular machinery for post-translational modifications and proper protein folding essential for PROKR2 functionality . When designing expression constructs, careful consideration of tag placement is critical, as C-terminal tags preserve signaling function while N-terminal tags can disrupt ligand-induced downstream pathway activation .
For research applications requiring stable expression, lentiviral transduction systems can generate cell lines with moderated, physiologically relevant expression levels. These stable lines more accurately reflect native receptor behavior than transient transfection systems, which often result in overexpression artifacts . When establishing such systems, functionality verification through calcium mobilization assays (using indicators like Fluo-4) or MAPK pathway activation (using reporter constructs like Egr1-luciferase) ensures that the recombinant receptor retains appropriate signaling capabilities .
A comprehensive approach to assessing PROKR2 trafficking combines multiple complementary techniques. Surface biotinylation assays provide quantitative measurement of plasma membrane-localized PROKR2, allowing clear distinction between properly trafficked receptors and those retained intracellularly . This technique reveals that while wild-type PROKR2 shows substantial cell surface expression, trafficking-defective mutants like P290S are virtually undetectable at the plasma membrane despite similar total expression levels .
Immunofluorescence microscopy with subcellular compartment markers offers spatial resolution of PROKR2 localization. By co-staining with markers for endoplasmic reticulum (ER), Golgi apparatus, and plasma membrane, researchers can track the progression of PROKR2 through the secretory pathway . For more dynamic analyses, pulse-chase experiments using metabolic labeling can reveal the kinetics of receptor maturation, trafficking, and degradation. This approach has demonstrated that mutant PROKR2 forms experience enhanced ER-associated degradation compared to wild-type receptors, but also undergo cycling between the ER and Golgi before eventual degradation .
Multiple signaling pathways should be assessed to comprehensively characterize PROKR2 functionality. Calcium mobilization assays using fluorescent indicators like Fluo-4 provide immediate readouts of receptor activation following ligand stimulation . For sustained signaling responses, MAPK pathway activation can be monitored using reporter constructs such as Egr1-luciferase, which responds to PROKR2-mediated signaling cascades .
Dose-response experiments across a range of prokineticin concentrations (typically 1-100 nM) can reveal subtle differences in signaling efficiency between wild-type and mutant receptors or between different experimental conditions. When designing these experiments, careful consideration of control conditions is essential—unstimulated baseline measurements and non-specific stimuli help distinguish receptor-specific responses from background cellular activity. Additionally, temporal analysis of signaling responses can detect differences in signal duration or desensitization kinetics that might be missed in single time-point measurements.
Immunoprecipitation coupled to mass spectrometry (IP-MS) provides a powerful approach for comparative interactome profiling between wild-type and mutant PROKR2 . This technique involves generating stable cell lines expressing either wild-type or mutant PROKR2 at modest, physiologically relevant levels to avoid artifacts associated with overexpression . Following immunoprecipitation of the receptor and its associated proteins, mass spectrometry identifies the interacting partners, revealing differences in protein-protein interactions that may explain altered trafficking or signaling.
For targeted analysis of specific interactions, co-immunoprecipitation followed by immunoblotting for proteins of interest can validate key findings from interactome studies. This targeted approach has revealed differential interactions between wild-type and mutant PROKR2 with components of the ER quality control machinery, explaining their distinct trafficking patterns . Additionally, proximity labeling techniques such as BioID or APEX can identify transient or weak interactions that might be missed by conventional immunoprecipitation approaches, providing a more comprehensive view of the PROKR2 interactome in living cells.
Mutations in PROKR2, particularly those affecting highly conserved residues like P290 in transmembrane domain 6, dramatically alter receptor trafficking through multiple mechanisms . While both wild-type and mutant PROKR2 initially enter the endoplasmic reticulum (ER), their subsequent fates diverge significantly. Comparative interactome studies have revealed that mutant PROKR2 interacts more extensively with ER quality control machinery, resulting in enhanced ER-associated degradation compared to the wild-type receptor .
PROKR2 and its ligand PROK2 exhibit complex roles in inflammatory conditions, with evidence suggesting both pro- and anti-inflammatory functions depending on the cellular context. In rheumatoid arthritis (RA) and osteoarthritis (OA), both PROK2 and its receptors PKR1 and PKR2 are expressed in synovial tissues, but with differential expression patterns . PKR1 expression is significantly downregulated in RA synovial tissue compared to OA synovial tissue, suggesting a role in disease-specific inflammatory processes .
To experimentally assess these functions, researchers can use tissue superfusion studies with synovial fibroblasts from RA and OA patients. Such studies have revealed that PROK2 suppresses IL-6 production from TNFα-prestimulated OA synovial fibroblasts, but this anti-inflammatory effect is attenuated in TNFα-prestimulated RA synovial fibroblasts . This phenomenon correlates with the upregulation of PKR1 in OA synovial fibroblasts, suggesting receptor-specific effects on inflammatory responses . These findings highlight the importance of studying PROKR2 function in disease-relevant primary cells rather than relying solely on recombinant systems.
Interestingly, mature GnRH neurons do not express PROKR2, indicating that its effects on GnRH secretion likely occur indirectly through other neuronal populations or signaling intermediates . The incomplete penetrance and variable expressivity of reproductive phenotypes in individuals with PROKR2 mutations suggest that other genetic factors modify the impact of PROKR2 dysfunction, a phenomenon termed oligogenicity . Indeed, "second hit" mutations in other reproductive genes have been documented in some pedigrees with PROKR2 mutations, highlighting the integrated nature of reproductive neuroendocrine networks .
Expression of functional GPCRs like PROKR2 presents significant technical challenges due to their complex structure and requirement for proper folding and post-translational modifications. When encountering low functional expression, researchers should first optimize codon usage for the expression system being employed, as suboptimal codons can reduce translation efficiency. Additionally, incorporation of signal sequences or fusion partners that enhance membrane targeting may improve functional expression levels.
Temperature modulation during expression can significantly impact PROKR2 functionality. Lower expression temperatures (28-30°C instead of the standard 37°C) can reduce protein synthesis rates, allowing more time for proper folding and reducing aggregation of misfolded receptors . For difficult-to-express variants like trafficking-defective mutants, chemical chaperones such as 4-phenylbutyrate or glycerol can be incorporated into culture media to stabilize folding intermediates and enhance functional expression.
Analyzing PROKR2 structural dynamics requires specialized approaches beyond conventional structural biology techniques. Site-directed fluorescence labeling at specific residues combined with fluorescence resonance energy transfer (FRET) can detect ligand-induced conformational changes in real-time. This approach provides valuable insights into the kinetics and magnitude of structural rearrangements following receptor activation, which may differ between wild-type and mutant receptors.
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers another powerful approach for analyzing PROKR2 dynamics without requiring protein crystallization. This technique provides information about the solvent accessibility of different receptor regions, revealing which domains undergo conformational changes upon ligand binding or during interactions with signaling partners. For more targeted structural analysis, cysteine accessibility methods can probe the exposure of specific residues in different receptor conformational states, providing detailed information about the structural transitions associated with receptor activation or inactivation.
Data inconsistencies across model systems are common when studying complex receptors like PROKR2 and require systematic investigation. Species-specific differences in PROKR2 sequence and post-translational modifications can significantly impact receptor function and should be explicitly considered when comparing results across bovine, human, and rodent systems. Direct sequence alignments and comparative expression studies in identical cellular backgrounds can help quantify these species-specific effects.
Expression level variations represent another major source of inconsistency, as PROKR2 function can differ dramatically between physiological expression and overexpression conditions. Quantitative receptor expression measurements (using techniques like radioligand binding or flow cytometry) should accompany functional data to ensure comparable receptor densities across experiments . Additionally, the cellular background significantly influences PROKR2 function through the availability of different G protein subtypes and downstream effectors. Researchers should characterize the endogenous signaling machinery in each model system and consider complementing heterologous expression studies with analyses in more physiologically relevant cell types when inconsistencies arise.
CRISPR-Cas9 genome editing technologies offer unprecedented opportunities for investigating PROKR2 function in physiologically relevant contexts. By introducing precise mutations that mimic those found in human patients or creating conditional knockout systems, researchers can study PROKR2's role in specific tissues or developmental stages without the confounding effects of compensatory mechanisms that often occur in conventional knockout models.
Single-cell transcriptomics and proteomics approaches are revealing previously unappreciated heterogeneity in PROKR2 expression and signaling across cell populations. These technologies can identify specific cell types that express PROKR2 within complex tissues and characterize how receptor expression changes during development or disease progression. Additionally, advanced imaging techniques like super-resolution microscopy and single-molecule tracking provide new insights into PROKR2 dynamics and organization at the cell surface, potentially revealing how receptor clustering or interactions with membrane microdomains influence signaling outcomes.
Given PROKR2's critical role in reproduction, targeted modulation of this receptor offers potential therapeutic approaches for both hypogonadism and fertility control. Small molecule agonists that can penetrate the blood-brain barrier might stimulate GnRH release in patients with partial PROKR2 deficiency, potentially restoring reproductive function. Conversely, antagonists could provide novel contraceptive approaches by suppressing the reproductive axis without the systemic effects of current hormonal methods.
PROKR2, like many GPCRs, likely functions not only as monomers but also as dimers or higher-order oligomers that may exhibit distinct signaling properties. Bioluminescence resonance energy transfer (BRET) and fluorescence resonance energy transfer (FRET) approaches offer powerful tools for studying these interactions in living cells. By tagging PROKR2 with appropriate donor and acceptor molecules, researchers can detect receptor proximity that indicates oligomerization and monitor how these interactions change in response to ligands or mutations.
Chemical crosslinking followed by mass spectrometry provides complementary structural information about the interfaces involved in PROKR2 oligomerization. This approach can identify specific residues that mediate receptor-receptor interactions, generating testable hypotheses about how mutations might disrupt oligomerization. For functional studies, the use of biased ligands that preferentially activate specific signaling pathways can reveal whether PROKR2 oligomers signal differently than monomers. Similarly, the development of nanobodies or small molecules that selectively stabilize or disrupt PROKR2 oligomers would provide valuable tools for dissecting the functional consequences of receptor oligomerization in both physiological and pathological contexts.