Recombinant Bovine Prostacyclin receptor (PTGIR)

Shipped with Ice Packs
In Stock

Description

Introduction

The Recombinant Bovine Prostacyclin Receptor (PTGIR) is a transmembrane protein expressed in Bos taurus (cattle). It binds prostacyclin (PGI₂), triggering intracellular signaling via G proteins to regulate vascular tone and platelet aggregation . Recombinant versions enable structural and functional studies, offering insights into cardiovascular therapies .

Expression Systems

Recombinant bovine PTGIR is produced in heterologous systems for research:

SystemProduct CodeTagPuritySource
E. coliCSB-CF018981BON-terminal 10xHis>90%Cusabio
Cell-freeMBS7028223Not specifiedN/AMyBioSource

Advantages of E. coli expression:

  • Cost-effective for large-scale production .

  • Yields functional protein for binding assays .

Signaling Mechanisms

Activation of recombinant bovine PTGIR triggers:

  • Gs pathway: Increases cAMP via adenylate cyclase, inhibiting platelet aggregation .

  • Gq pathway: Activates phospholipase C, mobilizing intracellular calcium .

  • Synergy with nitric oxide to amplify vasodilation .

Mutagenesis Studies

  • E116Q mutation: Constitutively activates the receptor, highlighting its role in G protein coupling .

  • R279C variant: Reduces ligand binding affinity, underscoring TMVII's importance .

Therapeutic Development

  • Agonist design: Targeting residues like D60 and D288 improves drug specificity .

  • Disease models: Used to study hypertension and atherosclerosis in vitro .

Recombinant Bovine PTGIR (Cusabio)

ParameterDetail
Molecular Weight~41 kDa (predicted)
Storage-20°C (short-term); -80°C (long-term)
BufferPBS with 50% glycerol, 0.02% sodium azide
ApplicationsLigand binding assays, antibody production

Challenges and Future Directions

  • Limitations: Low stability in non-lyophilized formats .

  • Innovations: Baculovirus and mammalian systems for improved post-translational modifications .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its inclusion during production.
Synonyms
PTGIR; Prostacyclin receptor; Prostaglandin I2 receptor; PGI receptor; PGI2 receptor; Prostanoid IP receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MADSCRNLTYVRDSVGPATSTLMFVAGVVGNGLALGILGARRHSRPSAFAVLVTGLGVTD LLGTCFLSPAVFAAYARNSSLLGLARGRPALCDAFAFAMTFFGLASTLILFAMAVERCLA LSHPYLYAQLDGPRRARLALPAIYAFCTIFCSLPFLGLGQHQQYCPGSWCFIRMRSAEPG GCAFLLAYASLVALLVAAIVLCNGSVTLSLCRMYRQQRRHQARCPRPRAGEDEVDHLILL ALMTGIMAVCSLPLTPQIRGFTQAIAPDSSEMGDLLAFRFNAFNPILDPWVFILFRKSVF QRLKLWFCCLYSRPAQGDSRTSLSQSASGRKDSSAPPALEGKKGNWVPLSAWGEGQGGPL PAVQLPTSTVGTPSKAGSEAAC
Uniprot No.

Target Background

Function

Receptor for prostacyclin (prostaglandin I2 or PGI2). This receptor's activity is mediated by G(s) proteins, which activate adenylate cyclase.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of bovine Prostacyclin receptor (PTGIR)?

Bovine PTGIR is a G-protein coupled receptor belonging to the G-protein coupled receptor 1 family. The protein consists of 382 amino acids with the complete sequence available for recombinant production. Its amino acid sequence includes multiple transmembrane domains typical of G-protein coupled receptors, with the expression region spanning positions 1-382 . The receptor contains characteristic structural motifs necessary for prostacyclin binding and signal transduction.

The primary structure includes segments forming seven transmembrane domains with both extracellular and intracellular regions. The receptor is primarily localized in the cell membrane, consistent with its function as a receptor for extracellular signaling molecules .

How does bovine PTGIR compare with human PTGIR?

While bovine PTGIR shares significant homology with human PTGIR, there are notable differences in amino acid sequence. Human PTGIR consists of 386 amino acid residues compared to the 382 amino acids in bovine PTGIR . Human PTGIR has a reported molecular mass of approximately 41 kDa and undergoes post-translational modifications, including glycosylation .

Structural analysis reveals conserved functional domains between species, reflecting the evolutionary importance of prostacyclin signaling. These similarities make bovine PTGIR a useful model for understanding prostacyclin receptor function across mammalian species, while acknowledging species-specific differences that may affect ligand binding properties and downstream signaling.

What detection methods are most effective for studying bovine PTGIR?

Several effective methods for studying bovine PTGIR include:

  • Western Blotting: Effective for detecting PTGIR protein expression levels in tissue or cell samples. Anti-PTGIR antibodies can be used to identify the receptor with appropriate controls to ensure specificity .

  • ELISA: Particularly useful for quantitative analysis of PTGIR expression or for measuring binding interactions. Commercial kits are available specifically designed for bovine PTGIR detection .

  • Immunofluorescence/Immunohistochemistry: These methods allow visualization of receptor localization within cells or tissues, providing insights into subcellular distribution patterns .

  • Binding Assays: Radioligand binding assays using labeled prostacyclin analogs, such as iloprost, can determine receptor affinity and density. For example, 3H-labeled iloprost has been used in competition binding studies with receptor antagonists like RO1138452 and RO3244794 .

  • Functional Assays: Measuring cAMP production following receptor activation provides a functional readout of receptor activity, as demonstrated in studies using the AlphaScreen assay platform .

How should researchers design experiments to study bovine PTGIR signaling pathways?

Designing robust experiments to study bovine PTGIR signaling requires careful consideration of multiple factors:

  • Receptor Expression Systems: When using recombinant systems, consider whether to use transient or stable transfection approaches. For transient systems, a bicistronic expression approach may be advantageous, as demonstrated in studies with prostacyclin production where combined gene transfer was superior to single gene approaches .

  • Signaling Pathway Analysis:

    • Measure cAMP production as a primary readout since PTGIR couples to Gs proteins

    • Implement time-course experiments to capture both rapid and delayed signaling events

    • Use selective inhibitors to dissect pathway components

  • Control Considerations:

    • Include α-amanitin treatment controls when studying transcriptional responses to distinguish between primary and secondary effects

    • Use structurally distinct antagonists like RO1138452 and RO3244794 as pharmacological controls

    • Include related receptor subtypes (EP receptors) as specificity controls

  • Data Verification Approach: Confirm findings using multiple methodologies. For example, when measuring gene expression changes, validate microarray results with real-time PCR as demonstrated in bovine developmental studies .

What are the optimal methods for expressing and purifying recombinant bovine PTGIR?

Expression and purification of functional recombinant bovine PTGIR requires specialized approaches due to its transmembrane nature:

  • Expression Systems:

    • Mammalian Cell Expression: HEK293 or CHO cells provide proper post-translational modifications

    • Insect Cell Expression: Baculovirus systems offer higher yields while maintaining most mammalian-like modifications

    • Cell-Free Systems: Less ideal but may be useful for structural studies

  • Expression Optimization Parameters:

    • Include signal sequences for proper membrane targeting

    • Consider fusion tags that don't interfere with receptor folding (C-terminal tags often preferred)

    • Implement temperature reduction strategies during induction phase

    • Supplement media with receptor stabilizers

  • Purification Strategy:

    • Solubilize membranes using mild detergents like DDM, LMNG, or digitonin

    • Implement two-step purification using affinity chromatography followed by size exclusion

    • For functional studies, consider reconstitution into nanodiscs or liposomes

  • Functionality Assessment:

    • Verify binding capacity using radiolabeled ligands

    • Assess structural integrity using circular dichroism or thermal shift assays

    • Confirm signaling competence in reconstituted systems

When producing recombinant PTGIR, storage in Tris-based buffer with 50% glycerol is recommended, and repeated freeze-thaw cycles should be avoided to maintain protein integrity .

How can researchers effectively differentiate between specific PTGIR-mediated effects and non-specific prostanoid actions?

Differentiating specific PTGIR effects from general prostanoid actions requires careful experimental design:

  • Pharmacological Approaches:

    • Use structurally distinct selective antagonists such as RO1138452 (imidazol derivative, pKi=9.3) and RO3244794 (benzofuran derivative, pKi=7.7) to confirm PTGIR involvement

    • Employ stable prostacyclin analogs like carbaprostacyclin (cPGI2) that preferentially activate PTGIR

    • Conduct comprehensive receptor profiling to rule out off-target effects

  • Molecular Techniques:

    • Implement PTGIR-specific siRNA or CRISPR/Cas9 knockout models

    • Use site-directed mutagenesis to identify critical binding residues

    • Conduct parallel experiments in cells lacking PTGIR expression

  • Control Experiments:

    • Screen compounds against related prostanoid receptors (EP1-4, DP, FP, TP)

    • Assess cyclooxygenase (COX) inhibition potential of test compounds

    • Include phosphodiesterase inhibitors like IBMX to prevent cAMP degradation when measuring downstream signaling

  • Data Analysis Approach:

    • Calculate antagonist affinities (pKi values) across multiple assay formats

    • Implement Schild analysis to confirm competitive antagonism

    • Use statistical approaches that account for biological variability

What factors influence bovine PTGIR expression levels in different tissue types?

PTGIR expression varies considerably across bovine tissues, regulated by multiple factors:

  • Developmental Stage: Transcriptome analyses in bovine matured oocytes and embryos show dynamic expression patterns of numerous genes, including signaling receptors like PTGIR. Expression levels change significantly between matured oocytes (MII) and 8-cell-stage embryos .

  • Transcriptional Regulation:

    • Key transcription factors such as NFYA influence receptor expression

    • Epigenetic modifications, particularly DNA methylation via DNMT1, regulate gene accessibility

    • Chromatin remodeling factors like SWI/SNF and SMARCAL1 impact expression levels

  • Physiological Conditions:

    • Inflammatory states upregulate expression through NF-κB pathways

    • Hypoxic conditions alter expression via HIF-1α mechanisms

    • Hormonal influences, particularly estrogen and glucocorticoids, modulate receptor levels

  • Experimental Assessment Methods:

    • Quantitative real-time PCR with appropriate housekeeping genes like GAPDH

    • Protein quantification through Western blot or ELISA

    • Microarray analysis validated with real-time PCR

How can researchers effectively optimize transfection protocols for bovine PTGIR studies?

Optimizing transfection for bovine PTGIR studies requires consideration of multiple parameters:

  • Vector Design Considerations:

    • Use species-matched promoters for optimal expression

    • Consider bicistronic vector systems when studying interactions with other components of the prostacyclin pathway

    • Include appropriate tag sequences that don't interfere with receptor function

  • Transfection Optimization Parameters:

    ParameterRecommended RangeNotes
    DNA purityA260/280 > 1.8Critical for transfection efficiency
    DNA:transfection reagent ratio1:2-1:4Requires cell-specific optimization
    Cell confluency70-80%Ensures optimal uptake
    Post-transfection recovery24-48 hoursAllow for protein expression
  • Viral vs. Non-viral Methods:

    • Adenoviral transfection shows high efficiency for primary cells

    • For co-expression studies, adenoviral titers should be carefully optimized. Studies indicate optimal ratios of 50-100 plaque forming units (pfu) of Ad-COX-1 to 50 pfu of Ad-PGIS per cell

    • Non-viral methods may be preferable for stable integration studies

  • Verification Approaches:

    • Confirm expression via Western blot, flow cytometry, or immunofluorescence

    • Validate functionality through cAMP assays or calcium mobilization studies

    • For co-expression systems, verify all components are expressed at desired ratios

How can recombinant bovine PTGIR be utilized to study prostacyclin signaling in cardiovascular research models?

Recombinant bovine PTGIR provides valuable tools for cardiovascular research:

  • Vascular Homeostasis Studies:

    • Investigate the balance between prostacyclin and thromboxane signaling in endothelial function

    • Examine how PTGIR activation contributes to vascular tone regulation

    • Study the role of PTGIR in limiting platelet aggregation and thrombus formation

  • Gene Transfer Approaches:

    • Implement combined cyclooxygenase-1 (COX-1) and prostacyclin synthase (PGIS) gene transfer to selectively augment prostacyclin production

    • This approach allows for increased prostacyclin without concurrent overproduction of other prostanoids

    • Optimization of expression ratios is critical - research indicates specific viral titers produce optimal results

  • Pathological Model Applications:

    • Study endothelial dysfunction in diabetes models

    • Investigate potential therapeutic applications in pulmonary hypertension

    • Examine vascular inflammation mechanisms

  • Comparative Studies:

    • Use bovine PTGIR as a comparative model to human PTGIR to understand conserved signaling mechanisms

    • Apply findings to agricultural research on bovine cardiovascular health

    • Develop translational applications between species

Research has demonstrated that prostacyclin acts in concert with nitric oxide and other endothelial molecules to maintain vascular homeostasis and vasoprotection, highlighting the importance of PTGIR signaling in cardiovascular physiology .

What are the current challenges in quantifying PTGIR expression and activity in primary cell cultures?

Researchers face several technical challenges when studying PTGIR in primary cells:

  • Expression Level Variability:

    • Primary cells often express lower receptor levels than immortalized lines

    • Expression can vary significantly between tissue sources and with passage number

    • Mitigation strategy: Implement early passage restrictions and consistent isolation protocols

  • Detection Sensitivity Limitations:

    • Low endogenous expression requires highly sensitive detection methods

    • Western blot may not provide adequate sensitivity for endogenous receptors

    • Solution approach: Employ amplification techniques such as proximity ligation assays or implement AlphaScreen technology as used in functional PTGIR studies

  • Functional Assay Challenges:

    • cAMP responses may be confounded by other Gs-coupled receptors

    • Receptor desensitization occurs rapidly, complicating time-course studies

    • Optimization approach: Use selective antagonists like RO1138452 and RO3244794 to confirm PTGIR specificity

  • Data Normalization Considerations:

    • Selection of appropriate housekeeping genes is critical for qPCR studies

    • GAPDH has been validated as a stable reference gene in some bovine cell systems

    • Implement multiple reference genes and validate stability using statistical approaches

How can researchers analyze contradictory data regarding PTGIR signaling outcomes?

When encountering contradictory results in PTGIR research, systematic analysis approaches should be employed:

  • Experimental Variables Assessment:

    • Evaluate differences in experimental models (cell types, species, in vitro vs. in vivo)

    • Compare methodological approaches (direct binding vs. functional readouts)

    • Assess reagent specificity and validation status

  • Receptor Context Considerations:

    • Analyze membrane microdomain localization effects on signaling

    • Consider receptor oligomerization and heterodimer formation

    • Evaluate post-translational modification status (glycosylation patterns)

  • Signal Integration Analysis:

    • Implement systems biology approaches to map complex signaling networks

    • Consider pathway crosstalk, particularly with other prostanoid receptors

    • Evaluate temporal aspects of signaling (rapid vs. sustained responses)

  • Statistical and Validation Approaches:

    • Use statistical methods appropriate for the experimental design, such as those implemented in the relative expression software tool (REST) for gene expression analysis

    • Confirm findings using multiple methodological approaches

    • Consider meta-analysis techniques to integrate contradictory findings from multiple studies

What are the optimal conditions for developing binding assays for bovine PTGIR?

Developing robust binding assays for bovine PTGIR requires careful optimization:

  • Radioligand Selection and Parameters:

    • Use 3H-labeled iloprost, a stable prostacyclin analog with high affinity

    • Typical concentration ranges: 0.1-10 nM for saturation binding

    • Non-specific binding determination: defined using excess unlabeled ligand (>100× concentration)

  • Membrane Preparation Optimization:

    • Harvest cells at 90% confluence and wash thoroughly with PBS

    • Prepare membranes through differential centrifugation (300-500 × g followed by higher speed centrifugation)

    • For enhanced detection, consider coupling to wheat germ agglutinin-coupled scintillation proximity assay beads (WGA-SPA beads)

  • Assay Buffer Composition:

    ComponentConcentrationPurpose
    HEPES5-25 mMpH buffering
    MgCl₂5-10 mMReceptor stabilization
    NaCl100-150 mMIonic strength
    BSA0.1%Prevent non-specific binding
    IBMX0.5 mMInhibit phosphodiesterases
  • Optimization and Validation Approaches:

    • Perform time-course experiments to determine equilibrium binding time

    • Validate assay with known antagonists like RO1138452 (pKi=9.3) and RO3244794 (pKi=7.7)

    • Ensure assay reliability through replicate analysis and appropriate statistical testing

How should functional assays for bovine PTGIR signaling be designed and interpreted?

Designing robust functional assays for PTGIR signaling requires addressing several key considerations:

  • cAMP Measurement Design:

    • Cell preparation: Harvest cells at 90% confluence, wash with PBS, and resuspend in appropriate stimulation buffer

    • Include phosphodiesterase inhibitors such as IBMX (0.5 M) to prevent cAMP degradation

    • Implement detection using sensitive methods like AlphaScreen technology

    • Plating density: Optimize to approximately 100,000 cells per well for a 96-well format

  • Agonist/Antagonist Testing Protocol:

    • For inhibition experiments, pre-incubate cells with antagonists before agonist addition

    • Use stable prostacyclin analogs like carbaprostacyclin (cPGI2) at defined concentrations (e.g., 10 nM)

    • Implement appropriate incubation times (typically 30 minutes for agonist response)

    • Include appropriate positive controls and full concentration-response curves

  • Signal Detection Optimization:

    • For AlphaScreen assays, add donor beads with biotin-cAMP in lysis buffer

    • Incubate plates for 1 hour with gentle shaking in the dark

    • Use specialized detection equipment like AlphaScreen Fusion analyzers

  • Data Analysis and Interpretation:

    • Convert raw signals to cAMP concentrations using standard curves

    • Calculate EC50/IC50 values using appropriate curve-fitting software

    • Perform Schild analysis for antagonist studies to determine mechanism of action

    • Consider pathway amplification when interpreting response magnitudes

How does bovine PTGIR compare with PTGIR from other species in terms of structure and function?

PTGIR shows important evolutionary conservation and species-specific differences:

  • Cross-Species Structural Comparison:

    • Human PTGIR: 386 amino acids, 41 kDa

    • Bovine PTGIR: 382 amino acids

    • Other reported orthologs: mouse, rat, frog, zebrafish, and chimpanzee

  • Functional Domain Conservation:

    • Transmembrane domains show highest sequence conservation

    • Ligand binding pocket residues are generally preserved across mammalian species

    • G-protein coupling domains maintain functional motifs despite sequence variations

  • Species-Specific Differences:

    • Glycosylation patterns vary between species, potentially affecting receptor stability and trafficking

    • Pharmacological response profiles show subtle species differences

    • Desensitization and internalization kinetics may differ between species

  • Evolutionary Significance:

    • Conservation across vertebrates indicates fundamental importance in cardiovascular physiology

    • Analysis of sequence variations provides insights into structure-function relationships

    • Species adaptations may reflect environmental and physiological differences

What methodological approaches are recommended for studying species-specific variations in PTGIR function?

Investigating species differences in PTGIR function requires specialized approaches:

  • Comparative Binding Studies:

    • Direct comparison of binding affinity across species using standardized protocols

    • Competition binding with species-specific membrane preparations

    • Determination of binding kinetics (association/dissociation rates) across species

  • Molecular Engineering Approaches:

    • Creation of chimeric receptors to identify domains responsible for species differences

    • Site-directed mutagenesis of non-conserved residues

    • Homology modeling based on crystal structures of related GPCRs

  • Signaling Comparison Methodology:

    • Parallel signal transduction studies in matched cell backgrounds

    • Comparison of signaling kinetics and magnitude across species

    • Analysis of pathway bias between G-protein and β-arrestin signaling

  • Functional Response Analysis:

    • Comparative vasodilation studies in isolated vessel preparations

    • Platelet aggregation inhibition across species

    • Species-specific inflammatory response modulation

What are common issues in recombinant PTGIR expression and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant PTGIR:

  • Low Expression Levels:

    • Problem: Membrane proteins like PTGIR often express poorly

    • Solution: Optimize codon usage for expression system, include molecular chaperones, lower expression temperature, or use specialized expression strains

  • Protein Misfolding:

    • Problem: Improper folding leading to aggregation or degradation

    • Solution: Include stabilizing agents in culture media, optimize signal sequences, or implement directed evolution approaches to identify more stable variants

  • Functional Activity Loss:

    • Problem: Expressed protein lacks binding or signaling capacity

    • Solution: Ensure proper post-translational modifications, optimize detergent selection for membrane extraction, or implement quality control using ligand-binding verification

  • Storage Stability Issues:

    • Problem: Activity loss during storage

    • Solution: Store in Tris-based buffer with 50% glycerol, avoid repeated freeze-thaw cycles, and prepare working aliquots for short-term storage at 4°C (up to one week)

How can researchers verify and troubleshoot PTGIR-mediated signaling in experimental systems?

Verifying authentic PTGIR signaling and troubleshooting experimental challenges:

  • Validation Approaches:

    • Pharmacological validation using structurally distinct agonists and antagonists

    • Genetic verification through knockout/knockdown and rescue experiments

    • Signal pathway mapping using selective inhibitors

  • Common Problems and Solutions:

    IssuePossible CausesTroubleshooting Approach
    No cAMP responseReceptor not expressed/functionalVerify protein expression, check coupling integrity
    High backgroundEndogenous receptors, constitutive activityUse selective antagonists, include negative controls
    Poor reproducibilityReceptor desensitization, variable expressionStandardize stimulation protocols, establish stable cell lines
    Non-specific effectsOff-target compound activityScreen compounds against related receptors and enzymes
  • Advanced Verification Methods:

    • BRET/FRET approaches to directly measure receptor-G protein interactions

    • Label-free cellular assays to capture integrated cellular responses

    • Multiplexed signaling readouts to examine pathway specificity

  • Data Interpretation Guidelines:

    • Implement appropriate positive and negative controls

    • Consider time-dependent signaling changes

    • Use concentration ranges that span at least 2 logs below and above expected EC50/IC50

What emerging technologies are likely to advance bovine PTGIR research?

Emerging technologies are poised to transform PTGIR research:

  • Advanced Structural Biology Approaches:

    • Cryo-electron microscopy for membrane protein structural determination

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

    • Computational approaches for predicting ligand binding and conformational changes

  • Single-Cell Analysis Technologies:

    • Single-cell RNA sequencing to analyze receptor expression heterogeneity

    • Live-cell imaging with fluorescent biosensors to visualize signaling in real-time

    • Mass cytometry for multiparameter analysis of signaling pathways

  • CRISPR-Based Technologies:

    • Precise genome editing for introducing mutations or tagging endogenous receptors

    • CRISPRi/CRISPRa for modulating receptor expression

    • Base editing for introducing specific amino acid substitutions

  • Microfluidic and Organ-on-Chip Technologies:

    • Development of vascular models incorporating flow conditions

    • Integration of multiple cell types to model complex PTGIR signaling in tissue context

    • High-throughput screening applications for identifying novel ligands

What are the most promising therapeutic applications emerging from bovine PTGIR research?

Research on bovine PTGIR contributes to several promising therapeutic directions:

  • Cardiovascular Applications:

    • Selective prostacyclin production augmentation through combined COX-1 and PGIS gene transfer shows potential for therapeutic applications

    • Development of novel prostacyclin analogs with improved stability and specificity

    • Targeted delivery strategies for vascular protection

  • Inflammatory Disease Applications:

    • Exploration of PTGIR modulators for chronic inflammatory conditions

    • Investigation of receptor-specific effects on immune cell function

    • Development of combination therapies targeting multiple prostanoid receptors

  • Comparative Medicine Benefits:

    • Insights from bovine models informing human therapeutic development

    • Veterinary applications for bovine cardiovascular and inflammatory conditions

    • One Health approaches integrating findings across species

  • Precision Medicine Approaches:

    • Receptor variant-specific therapeutic strategies

    • Biomarker development for patient stratification

    • Targeted signaling pathway modulation based on disease mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.