Recombinant Bovine Prostaglandin D2 receptor (PTGDR)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Prostaglandin D₂ Receptor (PTGDR)

The recombinant bovine prostaglandin D₂ receptor (PTGDR) is a synthetic version of the endogenous bovine PTGDR protein, produced through recombinant DNA technology. PTGDR is a G protein-coupled receptor (GPCR) that mediates the biological effects of prostaglandin D₂ (PGD₂), a lipid signaling molecule involved in inflammation, allergic responses, and immune regulation. The recombinant form is engineered for research, diagnostic, and therapeutic applications, enabling precise study of its structure, function, and role in bovine physiology and pathology.

Molecular Structure and Characteristics

The bovine PTGDR protein is a multi-pass membrane GPCR with key structural features:

  • Amino Acid Sequence: 359 residues (human homolog; bovine sequence likely similar) .

  • Molecular Weight: ~40.3 kDa (human); bovine variant reported as 40,372 Da .

  • Cellular Localization: Expressed on the plasma membrane .

  • Post-Translational Modifications:

    • N-glycosylation sites at Asn-10, Asn-90, and Asn-297 (human homolog; bovine may share conserved sites) .

    • Phosphorylation by protein kinase C in cytoplasmic domains .

FeatureBovine PTGDRHuman PTGDR
UniProt CodeA5D7K8 Q13258
Molecular Weight40,372 Da 40,276 Da
G Protein CouplingGs-protein (elevates cAMP) Gs-protein (cAMP/Ca²⁺ signaling)

Functional Mechanisms

PTGDR activates Gs-protein signaling, leading to:

  1. Adenylate Cyclase Activation: Conversion of ATP to cyclic AMP (cAMP), a secondary messenger .

  2. Calcium Mobilization: Intracellular Ca²⁺ release, enhancing cellular responses .

  3. Immune Modulation:

    • Anti-inflammatory effects: Inhibition of eosinophil apoptosis and dendritic cell migration (DP1 receptor subtype) .

    • Pro-inflammatory effects: Stimulation of TH2 cells and eosinophils (DP2 receptor subtype in humans; bovine DP1 may differ) .

Key Pathways:

  • PGD₂ Synthesis: Catalyzed by lipocalin-type PGD synthase (L-PGDS), which binds retinoic acids and facilitates PTGDR surface expression .

  • Retinoic Acid Regulation: Retinoic acid (ATRA) upregulates PTGDR via RARα in human models; bovine mechanisms remain unstudied .

Recombinant Production and Utility

Recombinant bovine PTGDR is produced in systems like HEK293 cells or E. coli for structural and functional studies. Applications include:

  • ELISA Kits: Quantification of PTGDR levels in bovine serum, plasma, or cell culture supernatants (e.g., Assay Genie’s BOEB0741 kit) .

  • Drug Discovery: Screening agonists/antagonists for inflammatory or allergic diseases .

ParameterBovine PTGDR ELISA Kit (BOEB0741)
TargetBovine PTGDR
Sample TypesSerum, plasma, tissue homogenates
Assay TypeSandwich ELISA
Detection MethodColorimetric (absorbance at 450 nm)
SensitivityData provided with kit

Disease Relevance

  • Inflammatory Responses: PTGDR modulates eosinophil and TH2 cell activity, implicating it in bovine asthma or allergic dermatitis .

  • Neurodegeneration: Human studies link PGD₂/PTGDR signaling to Parkinson’s-like pathology; bovine relevance is unexplored .

  • Immune Regulation: PGD₂ via PTGDR may suppress dendritic cell migration, potentially influencing vaccine efficacy or infection outcomes .

Challenges and Future Directions

  • Limited Bovine-Specific Data: Most research focuses on human or rodent models; bovine PTGDR’s role in disease remains understudied.

  • Regulatory Mechanisms: ATRA-mediated PTGDR regulation observed in humans (via RARα) requires validation in bovines .

  • Therapeutic Potential: Antagonists targeting PTGDR could mitigate inflammatory diseases but require bovine-specific toxicity and efficacy trials.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PTGDR; Prostaglandin D2 receptor; PGD receptor; PGD2 receptor; Prostanoid DP receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
PTGDR
Target Protein Sequence
MRPLFYRCHNTTSVEKGNSATMGGVLFSTGLVGNLLALGLLARSGLGSCPPRSPRPPPSV FYVLVFGLTITDLLGKCLVSPFVLSAYAQNRSLRELVPGSDSSLCQAFAFIMSFFGLAST LQLLAMALECWLSLGHPFFHRRHLTPRRGAMVAPVVGAFCLAFCALPLVGFGKFVQYCPG TWCFFQMVHEERSLSVLSYSVLYASLMLLLVLAIVLCNLSAMRNLYAMHLRLRGLLRPGS RERAEPGAGEREATPLHLEELDHLLLLALMTVLFTMCSLPLIYRAYYGAFKAVPEQNGTT EETEDLRALRFLSVISIVDPWIFIIFRTSVFRMFFRKIFIRPLIYRNWHSNSCQTNMESS L
Uniprot No.

Target Background

Function
Prostaglandin D2 receptor (PTGDR) acts as a receptor for prostaglandin D2 (PGD2). The receptor's activity is primarily mediated by G(s) proteins that stimulate adenylate cyclase, leading to an increase in intracellular cAMP levels. A mobilization of calcium is also observed, but without the formation of inositol 1,4,5-trisphosphate. PTGDR plays a role in the PLA2G3-dependent maturation of mast cells. PLA2G3 is secreted by immature mast cells and acts on nearby fibroblasts upstream to PTDGS to synthesize PGD2, which in turn promotes mast cell maturation and degranulation through PTGDR.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic structure and location of the PTGDR gene?

The PTGDR gene (also termed PTGDR1) in humans is located on chromosome 14 at position q22.1 (14q22.1), a chromosomal locus associated with asthma and other allergic disorders. The gene consists of 4 introns and 5 exons and encodes for a ~44 kilodalton protein as well as multiple alternative spliced transcript variants . For bovine PTGDR specifically, comparative genomics would suggest similar structural organization to the human counterpart, with species-specific variations in intron length and regulatory elements.

How is PTGDR expressed in different tissues and cell types?

PTGDR (DP1) is expressed primarily by cells involved in mediating allergic and inflammatory reactions, including:

  • Human and rodent mast cells

  • Basophils

  • Eosinophils

  • Th2 cells

  • Dendritic cells

It is also expressed in cells that contribute to allergic and inflammatory reactions, such as:

  • Airway epithelial cells

  • Vascular endothelium

  • Mucus-secreting goblet cells in nasal and colonic mucosa

  • Serous gland cells of the nose

In mice, PTGDR protein expression has been detected in placenta and testes. Additionally, mRNA transcripts have been identified in the meninges of the mouse brain by multiple reports. Single reports have also documented PTGDR in rat meninges, mouse thalamus, hippocampus, cerebellum, brainstem, and retina .

What are the primary ligands for the PTGDR receptor and their binding affinities?

Prostaglandin D2 (PGD2) is the primary endogenous ligand for PTGDR, binding with high affinity in the 0.5 to 1 nanomolar range. The relative potencies of various prostanoids in binding to and activating PTGDR are:

PGD2 >> PGE2 > prostaglandin F2α > PGI2 = thromboxane A2

PGD2 demonstrates more than 100-fold greater potency than PGE2 in binding to and stimulating PTGDR .

Additionally, several PGD2 metabolites that form via non-enzymatic rearrangements also bind to and activate PTGDR:

  • PDJ2 (binds almost as effectively as PGD2)

  • Δ12-PDJ2

  • 15-deoxy-Δ12,14-PGJ2

This hierarchical binding pattern provides important insights for researchers designing experimental ligands or therapeutic compounds targeting this receptor.

How do genetic variants in the PTGDR promoter region affect its expression and function?

Genetic variants in the PTGDR promoter region significantly impact gene expression and response to regulatory factors. In particular, variants with the mutated C nucleotide at the -197 position demonstrate remarkably higher promoter activity .

Research has identified that differential allelic occupancy at three key positions (-613, -549, and -197) determines modifications in transcription factor binding. Only specific mutated variants binding to:

  • PAX6, ETS-1, and ZFN652 (at -549 position)

  • MYC and SRF (at -197 position)

were observed to effectively activate the PTGDR promoter .

In silico analysis revealed putative binding differences between wild and mutated alleles that affect the binding affinity for numerous transcription factors including NF-AT, PAX6, EST-1, PPAR, RAR, RXR, GZF1, SORY, AP-1, NBRE, ZNF652, MAZF, and SRFF . These findings have important implications for understanding individual differences in PTGDR expression and potentially disease susceptibility.

What is the role of retinoic acid in regulating PTGDR expression?

Retinoic acid (RA) plays a significant role in modulating PTGDR expression through several mechanisms:

  • All-trans retinoic acid (ATRA) treatment significantly increases PTGDR promoter activity in transfected cells (p<0.001). When cells were stimulated with ATRA at 12 and 48 hours, all haplotypic variants exhibited higher activity compared to vehicle control .

  • After ATRA treatment, expression increases were observed in:

    • CYP26A1 (12-fold increase)

    • RARB (4-fold increase)

  • Bioinformatic analyses identified potential Retinoic Acid Response Elements (RARE) sequences in the PTGDR promoter region, suggesting a direct mechanism for RA regulation .

  • Quantitative real-time PCR analysis confirmed that PTGDR gene expression increases significantly after ATRA treatment compared to DMSO treatment, with differential responses observed depending on the promoter variant .

These findings are particularly relevant for understanding PTGDR regulation in the context of allergic conditions, as vitamin A (the precursor to retinoic acid) has been implicated in allergic disease development .

How does PTGDR contribute to allergic and inflammatory reactions?

PTGDR plays multiple roles in allergic and inflammatory processes:

  • The chromosomal locus containing PTGDR (14q22.1) is associated with asthma and other allergic disorders .

  • PGD2, the primary PTGDR ligand, enhances immune-mediated basophil and histamine release, exacerbating allergic reactions .

  • In experimental models, PTGDR2 pathway activation induces eosinophilic infiltration into lung and skin tissues, exacerbating allergic responses. Conversely, PTGDR antagonists ameliorate allergen-induced skin, lung, and respiratory inflammation .

  • In endotoxin-induced acute lung injury models, PTGDR2 activation causes early polarization of alveolar macrophages, leading to neutrophil recruitment and increased lung inflammation .

  • Increased PGD2 levels have been detected in the bronchoalveolar lavage fluid of severe asthma patients, further supporting PGD2/PTGDR's pro-inflammatory role .

  • Transcription factors affected by PTGDR promoter variants (such as ETS-1 and NF-AT) are involved in regulating Th2 cytokine expression and immune responses, providing additional mechanisms through which PTGDR gene regulation influences allergic inflammation .

What are the implications of PTGDR signaling in tumor development and progression?

Research over the past decade has revealed important roles for the PGD2/PTGDR signaling pathway in cancer biology. Dysregulation of PGD2 expression and its receptors has been associated with prognosis in multiple tumor types .

While the search results don't provide comprehensive details on specific mechanisms, studies examining PTGDR expression in tumor specimens have been conducted, suggesting the clinical relevance of this pathway in oncology . The involvement of transcription factors like MYC (identified in GWAS studies of allergic sensitization) and SRF (involved in airway remodeling through TGFβ signaling) in regulating PTGDR expression suggests potential mechanisms through which this pathway might influence tumor biology .

Given that inflammation is a hallmark of cancer, PTGDR's established role in inflammatory processes likely contributes to its impact on tumor development, though the specific effects may be context and tumor-type dependent.

What are the optimal methods for studying PTGDR expression in vitro?

Based on current research approaches, several complementary methods are recommended for comprehensive PTGDR expression analysis:

  • Quantitative real-time PCR (qPCR): Effective for measuring PTGDR mRNA expression levels following treatments such as ATRA or in different cell types. This approach successfully detected significant changes in PTGDR expression after retinoic acid stimulation .

  • Luciferase reporter assays: The Dual-Luciferase Reporter Assay System provides an effective method for measuring PTGDR promoter activity. This involves:

    • Transfecting cells with PTGDR promoter variants linked to luciferase reporters

    • Measuring both Firefly and Renilla luciferase activities

    • Normalizing Firefly to Renilla activity to correct for transfection efficiency

  • Transient transfection experiments: Studies have successfully used A549 lung epithelial cells for PTGDR expression and promoter studies, with protocols including:

    • Seeding cells in serum-free medium 24h before transfection

    • Replacing transfection medium with RPMI supplemented with 1% FBS after 5 hours

    • Treatment with 1μM ATRA or vehicle control

    • Incubating for 12-48 hours before analysis

For optimal results, experiments should be performed in triplicate with appropriate controls and standardized normalization procedures to ensure reproducibility and reliability .

What experimental models are most suitable for investigating PTGDR function?

Several experimental models have proven valuable for investigating different aspects of PTGDR biology:

  • Cell line models:

    • A549 lung epithelial cells: Successfully used for PTGDR promoter studies and expression analysis

    • Other respiratory or immune cell lines expressing PTGDR would be appropriate for functional studies

  • Primary cell cultures:

    • Cells naturally expressing PTGDR (mast cells, basophils, eosinophils, Th2 cells, dendritic cells)

    • Particularly valuable for examining physiological responses and signaling mechanisms

  • Mouse models:

    • Endotoxin-induced acute lung injury model: Demonstrates PTGDR2 role in alveolar macrophage polarization and neutrophil recruitment

    • Allergen-induced inflammation models: Show PTGDR antagonist effects on skin, lung, and respiratory inflammation

    • Knockout or transgenic PTGDR models would provide additional insights into receptor function

Model selection should be guided by the specific research question, with cell-based systems appropriate for molecular studies and animal models necessary for understanding complex physiological and pathological processes involving PTGDR.

How can researchers effectively measure PTGDR activity in different experimental settings?

Multiple complementary approaches can be employed to comprehensively assess PTGDR activity:

  • Gene expression analysis:

    • qPCR for mRNA quantification

    • Western blotting for protein levels

    • Immunohistochemistry for tissue localization

  • Promoter activity assessment:

    • Luciferase reporter assays with PTGDR promoter constructs

    • Analysis of transcription factor binding (ChIP assays)

    • In silico analysis of transcription factor binding sites

  • Functional assays:

    • Measurement of second messengers (cAMP, Ca2+) following receptor stimulation

    • Analysis of downstream signaling pathway activation

    • Cell migration assays (particularly for immune cells)

    • Cytokine/chemokine production measurement

    • Histamine release from basophils or mast cells

  • In vivo models:

    • Inflammation markers in bronchoalveolar lavage fluid

    • Tissue histology for inflammatory cell infiltration

    • Physiological measurements (e.g., airway hyperresponsiveness)

For the most robust results, researchers should employ multiple complementary approaches and include appropriate positive and negative controls to confirm specificity of PTGDR-mediated effects.

What are the emerging areas of PTGDR research with therapeutic potential?

The current understanding of PTGDR biology suggests several promising research directions:

  • PTGDR antagonism in allergic disease: Given PTGDR's role in exacerbating allergic reactions and the ameliorating effects of antagonists on allergen-induced inflammation , development of selective PTGDR inhibitors represents a valuable therapeutic approach.

  • Targeting PTGDR in cancer: The association between PGD2/PTGDR signaling and tumor prognosis suggests potential for therapeutic intervention, though more research is needed to determine whether inhibition or activation would be beneficial in specific cancer contexts.

  • Pharmacogenomic approaches: The impact of PTGDR promoter variants on expression and retinoic acid responsiveness indicates potential for personalized medicine approaches, where treatment strategies could be tailored based on a patient's PTGDR genetic profile.

  • Combined retinoic acid and PTGDR-targeted therapies: The regulatory relationship between retinoic acid and PTGDR expression suggests potential for combination approaches that modulate both pathways simultaneously.

  • Development of biomarkers: PGD2 levels in bronchoalveolar lavage fluid correlate with asthma severity , suggesting potential for PTGDR-related biomarkers in diagnosing and monitoring inflammatory conditions.

These research directions hold promise for translating basic PTGDR biology into clinical applications across multiple disease areas.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.