Recombinant Bovine Protein ARV1 (ARV1)

Shipped with Ice Packs
In Stock

Description

Role in Sterol Trafficking

ARV1 facilitates sterol transport from the ER to the Golgi, a process disrupted in arv1Δ mutants. This defect leads to:

  • Elevated free sterol levels in yeast (e.g., ergosterol accumulation) .

  • Altered membrane organization, contributing to hypersensitivity to antifungal drugs like fluconazole .

ER Stress and Lipid Bilayer Regulation

Deletion of ARV1 triggers:

  • Constitutive UPR activation via Ire1 and Hog1 pathways, linked to rDNA stability .

  • Enhanced reactive oxygen species (ROS) production in mammalian cells .

Functional Conservation Across Species

Studies in Saccharomyces cerevisiae and Candida albicans demonstrate:

  • Cross-species complementation: Fungal ARV1 homologues restore sterol trafficking defects in yeast .

  • Antifungal susceptibility: C. albicans arv1 mutants show reduced virulence in mouse models .

4. Potential Bovine Applications
While direct bovine ARV1 data is lacking, its homologues suggest roles in:

  • Cattle health: Modulating ER stress in bovine cells during viral infections or metabolic disorders.

  • Antifungal resistance: Targeting ARV1 in bovine-associated pathogens (e.g., Candida spp.).

Challenges and Gaps

  • Limited bovine-specific studies: No direct evidence of ARV1 expression or function in bovine systems.

  • Structural complexity: Transmembrane domains complicate recombinant production in heterologous systems.

  1. Characterize bovine ARV1 expression in tissues and developmental stages.

  2. Explore therapeutic applications in cattle diseases linked to lipid dysregulation or ER stress.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ARV1; Protein ARV1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-282
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
ARV1
Target Protein Sequence
MGTGGQNGLRPGKGNTEGVKEGKGKTDEVTMTSNTDASASCQYRCIECNQEAKELYRDYN HGVLKITICKSCQKPVDKYIEYDPVIILINAILCKAQAYRHILFNTKINMHGKLCVFCLL CEAYLRWWQLQDSSQSIDPDDFIRYAKEWDFYRMFAIASLEQTAYFIGIFAFLWVERPIR AKEKLNFTLLLKALLLSSYGKLLLIPAVIWEHDYTPLCLRLIKVFVLTSNFQAIRVTLNI NRKLAFLAILSGLLVESTMVYFFQRMEWAVGSDCAIYKSQDF
Uniprot No.

Target Background

Function

Recombinant Bovine Protein ARV1 (ARV1) acts as a mediator in endoplasmic reticulum (ER) cholesterol and bile acid homeostasis. It participates in sterol transport from the ER and their distribution into plasma membranes.

Database Links
Protein Families
ARV1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How conserved is ARV1 across species and what does this suggest about its evolutionary importance?

ARV1 is highly conserved across eukaryotic species, suggesting fundamental roles in cellular function. Unlike many lipid homeostatic proteins, ARV1 is unique in that it is not duplicated in most organisms (except plants) and does not share domains with other proteins .

The conservation is particularly evident in the N-terminal ARV1 homology domain (AHD), which contains the zinc-binding motif essential for function . Mutations affecting this region, such as p.(Lys59_Asn98del), have profound effects on protein function and are associated with severe clinical phenotypes in humans .

Comparative studies between bovine, human, and yeast ARV1 show that the functional domains are preserved, indicating evolutionary pressure to maintain the protein's structure and function. Human ARV1 can suppress defects in yeast arv1Δ cells, demonstrating functional conservation across vast evolutionary distances .

What experimental methods are recommended for handling recombinant bovine ARV1 protein?

When working with recombinant bovine ARV1 protein:

  • Storage recommendations: Store at -20°C in Tris-based buffer with 50% glycerol. For extended storage, keep at -80°C .

  • Avoid repeated freeze-thaw cycles which may compromise protein activity .

  • For working aliquots, store at 4°C for up to one week .

  • If using in enzyme assays, dilute to appropriate concentration in assay buffer immediately before use (e.g., 100, 33.33, 3.33, 1.0, 0.2667, 0.0667, 0.01, and 0.000667 µg/mL as demonstrated in published protocols) .

For optimal results, validate protein activity before experimental use, as transmembrane proteins can lose functionality if improperly handled or if the conformational structure is disrupted during purification.

How can recombinant bovine ARV1 be used in lipid-binding assays?

Lipid-binding assays using recombinant bovine ARV1 can be approached using several methodologies:

  • Liposome-binding assays: This highly validated method determines lipid-protein interactions by measuring the association of ARV1 with artificially prepared liposomes containing specific lipids of interest. The assay can be used to determine binding specificity for various lipids including cholesterol, phospholipids, and phosphoinositides .

  • Direct binding measurements: The binding affinity (EC₅₀) of ARV1 for various lipids can be quantified. Based on human ARV1 studies, you might expect bovine ARV1 to show highest affinity for PI(4)P (EC₅₀ ≈ 4.7 × 10⁻¹¹ M), followed by other monophosphorylated PIPs such as PI(5)P (EC₅₀ ≈ 1.6 × 10⁻⁹ M) and PI(3)P (EC₅₀ ≈ 1.5 × 10⁻⁸ M) .

A representative binding affinity table for human ARV1 that may guide experimental design for bovine ARV1:

PhospholipidEC₅₀, M ± S.D.
PI(4)P4.7 × 10⁻¹¹ ± 4.1 × 10⁻¹²
PG4.3 × 10⁻⁹ ± 2.1 × 10⁻¹⁰
PI(5)P1.6 × 10⁻⁹ ± 2.2 × 10⁻¹⁰
PA1.6 × 10⁻⁸ ± 1.2 × 10⁻⁹
PI(3)P1.5 × 10⁻⁸ ± 1.3 × 10⁻⁹
PS3.4 × 10⁻⁷ ± 1.1 × 10⁻⁸
CL4.7 × 10⁻⁷ ± 1.8 × 10⁻⁸
PC1.1 × 10⁻⁶ ± 1.6 × 10⁻⁷

When designing these experiments, it's crucial to include appropriate controls and to consider the oligomeric state of ARV1, as biochemical studies suggest it functions as a dimer in cells .

What are the methodological considerations for studying ARV1's role in cholesterol transport?

To study ARV1's role in cholesterol transport, researchers should consider these methodological approaches:

  • Fluorescent cholesterol analogs: Use fluorescently labeled cholesterol to track transport in cellular systems with modulated ARV1 expression. This allows visualization of cholesterol movement between organelles.

  • Cellular fractionation: Isolate different cellular compartments (ER, Golgi, plasma membrane) followed by lipid extraction and cholesterol quantification to determine how ARV1 affects cholesterol distribution.

  • Sterol esterification assays: Measure the conversion of free cholesterol to cholesteryl esters in cells with normal or altered ARV1 function, as ARV1 was originally identified as required for viability in the absence of sterol esterification .

  • Reconstitution systems: Use purified recombinant ARV1 in artificial membrane systems to directly measure cholesterol transfer between membranes.

  • Binding kinetics: Determine the association and dissociation rates between ARV1 and cholesterol using surface plasmon resonance or similar techniques.

When designing these experiments, it's important to consider that ARV1 might function as a cholesterol "sensor" rather than just a transporter, potentially regulating lipid homeostasis in response to cholesterol levels .

How does bovine ARV1 compare structurally and functionally to human ARV1, particularly in relation to disease-associated mutations?

Comparing bovine and human ARV1 offers insights into conserved functional domains and species-specific differences:

  • Sequence homology: The bovine ARV1 sequence shares high homology with human ARV1, particularly in the N-terminal AHD and transmembrane regions. The bovine protein consists of 271-282 amino acids, similar to the 271 amino acid human ARV1 .

  • Functional domains: Both contain the critical ARV1 homology domain (AHD) with zinc-binding motifs and multiple transmembrane domains. The key positions associated with human disease mutations, such as position 185 (p.L185del) and 189 (p.G189R), are located in the fourth transmembrane domain, suggesting this region has particular importance in both species .

  • Disease-associated regions: In humans, mutations in ARV1 cause developmental and epileptic encephalopathy 38 (DEE38), with some patients also developing dilated cardiomyopathy. The mutations cluster in specific regions:

    • N-terminal AHD (e.g., p.Lys59_Asn98del) - severe phenotype

    • Transmembrane domain 4 (e.g., p.G189R, p.L185del) - associated with DCM

    • C-terminal region (e.g., p.Thr266_Phe271del) - variable severity

  • Lipid binding profile: Human ARV1 shows highest affinity for PI(4)P (EC₅₀ = 4.7 × 10⁻¹¹ M), followed by other phospholipids. While specific binding data for bovine ARV1 is not provided in the search results, the high sequence conservation suggests similar binding preferences .

For researchers using bovine ARV1 as a model for human ARV1 function, focusing on the conserved functional domains is recommended, with particular attention to the AHD and transmembrane region 4, which appear critical for proper function across species.

What is the relationship between ARV1 and glycosylphosphatidylinositol (GPI) anchor biosynthesis?

The relationship between ARV1 and GPI anchor biosynthesis represents a complex area of investigation:

  • Mechanistic hypotheses: ARV1 has been hypothesized to function as a GPI flippase (or more accurately a scramblase, as it lacks ATPase activity), potentially facilitating the movement of GPI anchor precursors across the ER membrane . This function would be critical for the proper maturation of GPI-anchored proteins.

  • Clinical evidence: Patients with ARV1 mutations show reduced expression of GPI-anchored proteins at the cell surface. Specifically:

    • Neutrophils from patients with p.Thr266_Phe27del mutation show reduced levels of CD16, CD66b, CD55 & 59, and FLAER

    • Fibroblasts from patients with p.Lys59_Asn98del mutation show decreased CD59 and CD87

    • Fibroblasts from patients with p.Ser122Glnfs*7 mutation show reduced CD73 and CD109

    • Expression of wild-type human ARV1 in these cells rescues the phenotype

  • Complementation studies: Multiple ARV1 variants associated with human disease fail to complement GPI biosynthesis defects when expressed in yeast arv1Δ cells. The p.Gly189Arg variant, for example, could partially restore growth but not suppress GPI biosynthesis defects .

  • Possible direct vs. indirect effects: Despite mounting evidence, the question remains whether ARV1 directly participates in GPI-anchor biosynthesis or if the observed defects are secondary to other membrane abnormalities caused by ARV1 dysfunction .

For researchers investigating this relationship using bovine ARV1, functional complementation assays in yeast systems or rescue experiments in patient-derived cells would provide valuable insights into whether the bovine protein can substitute for human ARV1 in GPI biosynthesis.

What are the experimental challenges in studying ARV1 dimerization and how does oligomerization affect its function?

Studying ARV1 dimerization presents several experimental challenges and important functional considerations:

  • Biochemical evidence for dimerization: Biochemical studies suggest that ARV1 exists as a dimer in cells, with oligomerization being critical for function. Mutations predicted to disrupt dimerization cause weakened or complete loss of lipid binding activity .

  • Experimental challenges:

    • Preserving native membrane protein structure during purification

    • Distinguishing between specific dimerization and non-specific aggregation

    • Determining whether dimerization occurs in the membrane or during purification

    • Identifying the specific residues or domains involved in dimer formation

  • Methodological approaches:

    • Crosslinking studies: Chemical crosslinking of proteins in their native environment before extraction

    • Size exclusion chromatography: To separate monomeric and dimeric forms

    • Multi-angle light scattering: To determine absolute molecular weight

    • Förster resonance energy transfer (FRET): Using differentially labeled ARV1 proteins to detect dimerization in live cells

    • Site-directed mutagenesis: To identify residues critical for dimerization

  • Functional implications: Understanding dimerization is crucial because:

    • Amino acid mutations predicted to affect dimerization cause weakened or complete loss of lipid binding

    • The dimeric form may create a channel or pocket that facilitates lipid scrambling

    • Dimerization could regulate ARV1 activity in response to cellular conditions

When designing experiments with recombinant bovine ARV1, researchers should consider whether their experimental conditions preserve the native oligomeric state of the protein, as this appears critical for its lipid binding and transport functions.

What are common pitfalls in ARV1 protein expression systems and how can they be overcome?

Researchers face several challenges when expressing recombinant ARV1 protein:

  • Membrane protein solubility issues:

    • Challenge: As a multi-pass transmembrane protein, ARV1 can be difficult to express in soluble, correctly folded form.

    • Solution: Use specialized expression systems designed for membrane proteins, such as cell-free systems supplemented with lipids or detergents, or expression in insect cells which often handle membrane proteins better than bacterial systems.

  • Preserving protein functionality:

    • Challenge: The zinc-binding motif and correct folding are essential for ARV1 function.

    • Solution: Include zinc in expression and purification buffers; consider expressing only the soluble domains (such as the AHD) for certain applications; validate functionality through lipid binding assays.

  • Protein aggregation:

    • Challenge: Transmembrane proteins often aggregate during purification.

    • Solution: Optimize detergent type and concentration; use glycerol in storage buffers (as seen in commercial preparations with 50% glycerol) ; consider purifying the protein in nanodiscs or other membrane mimetics.

  • Low expression yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for the expression host; use stronger promoters; consider fusion tags that enhance solubility; optimize induction conditions for temperature, duration, and inducer concentration.

  • Tag interference with function:

    • Challenge: Tags used for purification may interfere with protein function, especially if placed near functional domains.

    • Solution: Test multiple tag positions (N-terminal vs. C-terminal); include tag cleavage sites; validate that the tagged protein retains lipid binding activity.

For recombinant bovine ARV1, the storage in Tris-based buffer with 50% glycerol at -20°C indicates successful strategies for maintaining protein stability after purification .

How can researchers validate that their recombinant ARV1 preparation has retained its native structure and function?

Validating the structural integrity and functionality of recombinant ARV1 requires multiple complementary approaches:

  • Structural validation:

    • Circular dichroism (CD) spectroscopy: To verify secondary structure content, especially important for confirming proper folding of the AHD domain

    • Limited proteolysis: Properly folded proteins often show distinct proteolytic patterns compared to misfolded variants

    • Thermal shift assays: To assess protein stability and proper folding

    • Size exclusion chromatography: To confirm the expected oligomeric state (dimeric for ARV1)

  • Functional validation:

    • Lipid binding assays: Test binding to known lipid partners like PI(4)P, which human ARV1 binds with highest affinity (EC₅₀ = 4.7 × 10⁻¹¹ M)

    • Complementation assays: Determine if the recombinant protein can rescue defects in yeast arv1Δ cells or cells from patients with ARV1 mutations

    • Scramblase activity: Measure the ability to facilitate lipid flip-flop in reconstituted membrane systems

  • Zinc binding validation:

    • Inductively coupled plasma mass spectrometry (ICP-MS): To quantify zinc content

    • Zinc-dependent activity assays: Compare activity with and without zinc or in the presence of zinc chelators

    • Site-directed mutagenesis: Mutate zinc-coordinating cysteines and test for loss of function

  • Dilution series in activity assays:

    • Following protocols similar to those used for rbSPAM1, create a dilution series (e.g., 100, 33.33, 3.33, 1.0, 0.2667, 0.0667, 0.01, and 0.000667 µg/mL) to determine the linear range of activity and confirm dose-dependent function

A comprehensive validation would include both structural and functional assessments to ensure that the recombinant protein maintains its native properties and can serve as a reliable tool for further research.

What are the most sensitive methods for detecting ARV1 interactions with binding partners in complex biological systems?

For detecting ARV1 interactions with binding partners in complex biological systems, researchers can employ these sensitive methods:

  • Proximity-based approaches:

    • BioID or TurboID: Fusion of ARV1 with a biotin ligase to biotinylate proximal proteins, followed by streptavidin pulldown and mass spectrometry identification

    • APEX2 proximity labeling: Similar to BioID but using an engineered peroxidase

    • Split-protein complementation: Such as BiFC (Bimolecular Fluorescence Complementation) to visualize interactions in living cells

  • Co-immunoprecipitation with advancements:

    • Crosslinking-assisted immunoprecipitation: To stabilize transient or weak interactions

    • Tandem affinity purification: For increased specificity and reduced background

    • Quantitative mass spectrometry: SILAC or TMT labeling to distinguish specific from non-specific interactions

  • Lipid interaction analysis:

    • Lipid overlay assays: Using purified ARV1 against immobilized lipids

    • Lipidomics coupled to immunoprecipitation: To identify lipids that co-purify with ARV1

    • Native mass spectrometry: To detect intact protein-lipid complexes

    • Hydrogen-deuterium exchange mass spectrometry: To map regions involved in lipid binding

  • Live-cell imaging techniques:

    • FRET or BRET: To detect protein-protein or protein-lipid interactions in living cells

    • Single-molecule tracking: To monitor ARV1 dynamics in relation to potential binding partners

    • Correlative light and electron microscopy: To visualize ARV1 localization at ultrastructural level

  • Functional screening approaches:

    • CRISPR screens: To identify genes whose disruption phenocopies or modifies ARV1 deficiency phenotypes

    • Synthetic genetic array analysis: To map genetic interactions, particularly applicable in yeast models

When interpreting results from these methods, it's important to correlate physical interactions with functional significance, particularly given ARV1's multiple proposed functions in lipid transport, GPI-anchor biosynthesis, and cholesterol homeostasis .

How might bovine ARV1 studies inform therapeutic approaches for human ARV1-related disorders?

Studying bovine ARV1 has several potential implications for therapeutic development for human ARV1-related disorders:

  • Structure-function relationships: The high conservation between bovine and human ARV1 makes bovine studies valuable for understanding how specific domains contribute to function. This knowledge could guide the development of:

    • Small molecule therapies targeting specific functional domains

    • Peptide-based approaches that might restore function to mutant ARV1 proteins

    • Gene therapy approaches that deliver functional domains rather than the entire protein

  • Disease mechanism insights: ARV1 mutations cause developmental and epileptic encephalopathy 38 (DEE38) and are associated with dilated cardiomyopathy in some patients . Bovine ARV1 studies could help determine whether:

    • The neurological symptoms result from GPI-anchor biosynthesis defects

    • The cardiomyopathy stems from altered cholesterol transport

    • Different mutations affect distinct functions of the protein

  • Metabolic pathway targeting: Since ARV1 regulates cholesterol trafficking and potentially acts as a lipid "rheostat/sensor" , bovine studies might reveal:

    • Alternate pathways that could be therapeutically enhanced when ARV1 is dysfunctional

    • Dietary interventions that might mitigate metabolic aspects of ARV1 deficiency

    • Secondary targets in lipid metabolism pathways that could be modulated

  • Phenotype severity correlation: Different ARV1 mutations cause varying disease severity:

    • Loss-of-function variants (p.S122Qfsstop7, p.W163stop) or N-terminal AHD splice variants (p.K59_N98del) cause severe phenotypes

    • Missense variants (p.G189R) or C-terminal modifications (p.T266_F271del) result in milder disease

Understanding how bovine ARV1 function is affected by comparable mutations could provide insights into therapeutic approaches tailored to mutation type.

  • Biomarker identification: Studies of bovine ARV1 might identify altered lipid profiles or GPI-anchored protein levels that could serve as biomarkers for:

    • Disease progression monitoring

    • Treatment response evaluation

    • Early diagnosis of ARV1-related disorders

As human ARV1-related disorders are rare and severe, bovine models provide essential tools for understanding disease mechanisms and developing therapeutic strategies.

What specific experimental design would be most effective for investigating ARV1's role in dilated cardiomyopathy?

To investigate ARV1's role in dilated cardiomyopathy (DCM), a comprehensive experimental design should include:

  • Cellular models:

    • Primary cardiomyocytes with ARV1 manipulation: Use CRISPR/Cas9 to create ARV1 knockout or introduce specific mutations (e.g., p.G189R, p.L185del) associated with DCM in humans

    • iPSC-derived cardiomyocytes: Generate from patients with ARV1 mutations and DCM; compare with isogenic controls where mutations have been corrected

    • Cardiac organoids: Develop 3D cardiac tissue models with varying ARV1 expression/mutation status to examine effects on tissue organization

  • Molecular and functional analyses:

    • Transcriptomics and proteomics: Compare gene/protein expression patterns between normal and ARV1-deficient cardiac cells

    • Lipidomics: Analyze cardiac cell membrane composition, with particular focus on cholesterol distribution and phosphoinositide levels

    • Calcium handling: Measure calcium transients and contractility in ARV1-mutant cardiomyocytes

    • Mitochondrial function: Assess respiratory capacity, as cardiac energy metabolism might be affected by altered lipid transport

  • Structural studies:

    • Electron microscopy: Examine cardiac sarcomere structure and mitochondrial morphology

    • Membrane organization: Analyze lipid raft composition and plasma membrane/ER cholesterol distribution

    • Contractile apparatus: Assess sarcomere organization and function in ARV1-deficient cells

  • Animal models:

    • Cardiac-specific ARV1 knockout: Generate bovine or other animal models with cardiac-specific deletion of ARV1 to examine heart-specific effects

    • Knock-in mutations: Create animals with the specific transmembrane domain mutations (position 185 or 189) associated with DCM in humans

    • Echocardiography and hemodynamic measurements: Track cardiac function over time in these models

  • Rescue experiments:

    • Gene therapy approaches: Test if wild-type ARV1 expression can rescue established cardiac phenotypes

    • Small molecule screening: Identify compounds that might restore proper lipid distribution in ARV1-deficient cardiac cells

    • Metabolic interventions: Test if specific lipid supplements or cholesterol-modifying drugs can ameliorate cardiac dysfunction

This multi-faceted approach would provide comprehensive insights into how ARV1 dysfunction leads to DCM and potentially identify therapeutic targets. The experimental design leverages the observation that mutations in the middle part of ARV1 (positions 185 or 189 of the conserved fourth transmembrane domain) are associated with DCM in humans .

How does the phospholipid binding profile of ARV1 influence its biological functions across different cellular compartments?

The phospholipid binding profile of ARV1 has profound implications for its biological functions across cellular compartments:

  • Phosphoinositide binding specificity:
    ARV1 shows highest affinity for PI(4)P (EC₅₀ = 4.7 × 10⁻¹¹ M), followed by PI(5)P (EC₅₀ = 1.6 × 10⁻⁹ M) and PI(3)P (EC₅₀ = 1.5 × 10⁻⁸ M) . This preference has significant functional implications:

    • PI(4)P is enriched in the Golgi and plasma membrane, suggesting ARV1 may facilitate lipid transport between these compartments and the ER

    • PI(3)P predominates in early endosomes, potentially linking ARV1 to endosomal trafficking

    • The binding preference suggests ARV1 might function analogously to OSBP/Osh4, which exchanges cholesterol for PI(4)P between ER and Golgi membranes

  • Membrane-specific functions:
    ARV1 binds diverse phospholipids with varying affinities:

    PhospholipidEC₅₀, M ± S.D.
    PG4.3 × 10⁻⁹ ± 2.1 × 10⁻¹⁰
    PA1.6 × 10⁻⁸ ± 1.2 × 10⁻⁹
    PS3.4 × 10⁻⁷ ± 1.1 × 10⁻⁸
    CL4.7 × 10⁻⁷ ± 1.8 × 10⁻⁸
    PC1.1 × 10⁻⁶ ± 1.6 × 10⁻⁷
    PE5.3 × 10⁻⁶ ± 1.3 × 10⁻⁷

    These binding preferences suggest:

    • Potential roles in mitochondrial membranes (due to CL binding)

    • Function in lipid signaling pathways (through PA binding)

    • Involvement in membrane asymmetry maintenance (PS binding)

  • Integrated model of ARV1 function:
    The phospholipid binding profile suggests ARV1 may function as:

    • A lipid sensor that monitors membrane composition in different compartments

    • A scramblase that facilitates lipid movement between membrane leaflets

    • A lipid transfer protein that exchanges cholesterol for specific phospholipids between membranes

  • Regulatory implications:

    • ARV1 binding to different phospholipids might regulate its activity in response to changing membrane composition

    • Dimerization could be influenced by specific phospholipid interactions

    • Post-translational modifications might alter binding preferences in different cellular contexts

  • Disease mechanisms:
    Mutations in ARV1 might disrupt specific phospholipid interactions, explaining why:

    • Some mutations primarily affect neurological function

    • Others lead to cardiac phenotypes

    • The severity varies with different mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.