Recombinant Bovine Protein Asterix (WDR83OS)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Bovine Protein Asterix (WDR83OS)

Recombinant Bovine Protein Asterix (WDR83OS), also known as Protein Asterix or C19orf56, is a transmembrane protein critical for membrane protein biogenesis. It functions as a subunit of the PAT complex (CCDC47-Asterix), acting as an intramembrane chaperone for hydrophilic transmembrane domains (TMDs) during their insertion into the endoplasmic reticulum (ER). The recombinant version is produced in E. coli via in vitro expression systems, with a 10xHis-tag for purification and a full-length sequence spanning residues 1–106 .

Functional Role in Membrane Protein Biogenesis

WDR83OS, as part of the PAT complex, stabilizes TMDs during co-translational insertion into the ER membrane. Key findings include:

  • Chaperone Activity: Binds hydrophilic TMDs to prevent misfolding or aggregation, facilitating proper assembly of multi-pass membrane proteins (e.g., GPCRs, TRAM2, ANO6) .

  • Obligate Complex: CCDC47 and Asterix form a stoichiometric complex; depletion of either protein disrupts the other’s stability .

  • Substrate Specificity: Prefers TMDs with internal polar residues (e.g., asparagine), as demonstrated by mutagenesis studies reducing Asterix-TMD interactions .

Affected Proteins:

Protein ClassExamplesImpact of PAT Depletion
GPCRsRhodopsin, β1-adrenergic receptorReduced surface expression
ER-resident proteinsTRAM2, ANO6Biogenesis defects
Ion channelsMutant TRPV6Impaired trafficking

Interacting Proteins and Pathways

InteractorFunctionSource
CCDC47PAT complex partner; ER-resident membrane protein
ATP13A2ATPase involved in cellular metal transport

Involved Pathways:

  • Membrane Protein Quality Control: Collaborates with UBQLN2 to monitor misfolded TMDs .

  • ER Translocon Regulation: Interacts with Sec61 and SPP during co-translational protein insertion .

Research Findings and Implications

  • Conservation: The PAT complex is conserved across eukaryotes, underscoring its evolutionary importance .

  • Therapeutic Potential: Dysregulation of WDR83OS may contribute to diseases linked to membrane protein misfolding (e.g., neurodegeneration) .

  • Mechanistic Insights: The PAT complex dissociates upon correct folding of substrates, similar to soluble chaperones .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand your specific needs. Should you require a particular format, please clearly specify it during the order process, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we advise brief centrifugation of the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your own applications.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
WDR83OS; PAT complex subunit Asterix; Protein WDR83OS homolog; Protein associated with the ER translocon of 10kDa; PAT-10; PAT10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-106
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
WDR83OS
Target Protein Sequence
MSANNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVA VYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQPMTPPW
Uniprot No.

Target Background

Function
Asterix (WDR83OS) is a component of the PAT complex, an endoplasmic reticulum (ER)-resident membrane multiprotein complex crucial for facilitating the insertion of multi-pass membrane proteins into membranes. The PAT complex functions as an intramembrane chaperone, directly interacting with nascent transmembrane domains (TMDs). It releases its substrates upon proper folding, ensuring optimal biogenesis of multi-pass membrane proteins. WDR83OS/Asterix, the substrate-interacting subunit of the PAT complex, relies on CCDC47 for its stability. WDR83OS/Asterix associates with the first transmembrane domain (TMD1) of the nascent chain, independent of the N-glycosylation of the chain and irrespective of the amino acid sequence and transmembrane topology of TMD1. The PAT complex exhibits a preference for binding to TMDs with exposed hydrophilic amino acids within the lipid bilayer, creating a membrane-embedded partially hydrophilic environment that facilitates the binding of TMD1.
Database Links
Protein Families
Asterix family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What expression systems are optimal for producing Recombinant Bovine Protein Asterix?

While E. coli is the most commonly documented expression system for Recombinant Bovine Protein Asterix , researchers should consider multiple expression platforms based on specific experimental requirements:

Expression SystemAdvantagesConsiderations for WDR83OSYield Potential
E. coliRapid growth, cost-effective, high yieldSuccessfully demonstrated for WDR83OS, requires optimization of induction conditionsHigh
Yeast (P. pastoris)Post-translational modifications, secretion capabilityCRISPR/Cas9 technologies available for strain optimizationMedium-High
Insect cellsMore complex eukaryotic modificationsPotentially useful for studying functional attributes requiring proper foldingMedium
Mammalian cellsMost authentic post-translational modificationsHigher cost, longer production timeLow-Medium

When selecting an expression system, researchers should consider that while E. coli has been successfully used for WDR83OS expression , other systems might be advantageous depending on research goals. For instance, yeast-based systems can be engineered using CRISPR/Cas9 for site-specific gene integration or unwanted gene knockout to improve recombinant protein production .

How should Recombinant Bovine Protein Asterix be properly stored and reconstituted?

Proper handling of Recombinant Bovine Protein Asterix is critical for maintaining its stability and activity:

Storage recommendations:

  • Store lyophilized powder at -20°C to -80°C upon receipt

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended)

  • Create small working aliquots to minimize freeze-thaw cycles

Storage buffer composition:

  • Tris/PBS-based buffer

  • 6% Trehalose

  • pH 8.0

Researchers should note that repeated freezing and thawing significantly reduces protein activity and should be strictly avoided.

How can gene editing technologies like CRISPR/Cas9 be applied to enhance expression of Recombinant Bovine Protein Asterix?

CRISPR/Cas9 technology offers several strategies to optimize expression systems for Recombinant Bovine Protein Asterix:

For prokaryotic expression (E. coli):

  • Knockout of proteases that may degrade the recombinant protein

  • Modification of regulatory elements to enhance expression

  • Integration of chaperone genes to improve proper folding

For eukaryotic expression systems:

  • Yeast systems optimization:

    • CRISPR/Cas9 can be used for site-specific gene integration without selective markers

    • Multiplexed gene deletions can remove competing metabolic pathways

    • Modification of existing expression strains for markerless whole-genome modifications

  • Insect cell engineering:

    • Various insect U6 promoters can be utilized to construct CRISPR-Cas9 vectors

    • Site-specific genome editing can alter protein glycosylation patterns

    • Engineering approaches for enhanced expression of multiple genes simultaneously

The efficiency of homologous recombination machinery differs between expression systems. For example, while P. pastoris has less effective recombination compared to S. cerevisiae, CRISPR/Cas9 technologies have been established to overcome this limitation, allowing for marker-less genome engineering with integration efficiencies approaching 100% in ku70 deletion strains .

What methodological approaches can be used to verify the functional activity of Recombinant Bovine Protein Asterix?

Verification of functional activity for Recombinant Bovine Protein Asterix requires a multi-faceted approach:

Structural integrity assessment:

  • SDS-PAGE analysis (protein should show >90% purity)

  • Western blot using specific antibodies

  • Circular dichroism to analyze secondary structure elements

  • Size exclusion chromatography to verify oligomeric state

Functional assays:

  • Binding assays:

    • Co-immunoprecipitation with known interaction partners

    • Surface plasmon resonance to measure binding kinetics

    • Pull-down assays using the His-tag

  • Activity assessments:

    • Analysis of ER translocon association

    • Cellular localization studies using fluorescently tagged protein

    • Complementation assays in knockout cell lines

  • Immunological methods:
    Similar to approaches used for other recombinant proteins, researchers can adapt ELISA-based methods to detect:

    • Specific binding using capture antibodies diluted in carbonate buffer (pH 9.6, 0.01 M)

    • Signal detection using antibodies diluted in PBST-g (1:1,500 [vol/vol])

These methodologies can be adapted from protocols established for other recombinant proteins while being tailored to the specific characteristics of WDR83OS.

What are the considerations for developing fusion proteins with Recombinant Bovine Protein Asterix?

Creating fusion proteins with Recombinant Bovine Protein Asterix requires careful design considerations:

Design principles:

  • Terminal selection:

    • N-terminal fusions (as demonstrated with His-tag) have been successful

    • C-terminal fusions should account for potential functional domains at the C-terminus

  • Linker design:

    • Flexible linkers (e.g., GGGGS repeats) may be optimal for independent domain folding

    • Alpha-helical linkers provide rigidity when domain separation is desired

    • Cleavable linkers allow post-purification separation if needed

  • Tag selection:
    Commonly used tags include:

    • Affinity tags: His (demonstrated for WDR83OS) , GST, MBP

    • Solubility enhancers: Thioredoxin, SUMO

    • Detection tags: FLAG, GFP, RFP

Expression optimization:
When designing fusion proteins, researchers should consider strategies similar to those used for other successful chimeric proteins:

  • Codon optimization for the expression system

  • Removal of rare codons or secondary structures in mRNA

  • Optimization of the Shine-Dalgarno sequence for prokaryotic expression

Validation approaches:
Similar to approaches used for other fusion proteins like the ESAT-6:CFP-10 fusion or FnBP+ClfA fusion , researchers should:

  • Verify structural integrity through biophysical methods

  • Confirm both components retain functionality

  • Assess stability under experimental conditions

Successful fusion protein design, as demonstrated in other systems, can lead to enhanced functionality or novel applications. For example, the FC and FCGS chimeric proteins have been shown to induce high levels of antibodies in mice models , suggesting potential immunological applications for properly designed fusion proteins.

How do different expression conditions affect post-translational modifications of Recombinant Bovine Protein Asterix?

Post-translational modifications (PTMs) of Recombinant Bovine Protein Asterix vary significantly based on the expression system:

Expression SystemCommon PTMsLimitationsConsiderations for WDR83OS
E. coliLimited (primarily lacks glycosylation)No glycosylation; limited disulfide bond formationCurrently used system; may lack native PTMs
YeastGlycosylation (high mannose), phosphorylationHypermannosylation differs from mammalian glycosylationPotential for glycoengineering
Insect cellsPhosphorylation, O-linked glycosylationSimpler N-glycans than mammalian cellsUseful for complex PTMs; CRISPR can alter glycosylation
Mammalian cellsComplex glycosylation, phosphorylation, acetylationHigher cost, lower yieldMost authentic PTMs

Optimizing PTMs:

  • For E. coli expression:

    • Co-expression with chaperones can assist proper folding

    • Expression at lower temperatures (16-25°C) may improve folding

    • Use of specialized E. coli strains (Origami, SHuffle) for disulfide bond formation

  • For eukaryotic systems:

    • Glycoengineering through CRISPR/Cas9 modification of glycosylation pathways

    • Control of culture conditions (pH, temperature, dissolved oxygen)

    • Media optimization for desired modification patterns

While the native PTMs of bovine WDR83OS are not fully characterized in the provided search results, researchers should consider that the E. coli-expressed protein currently available likely lacks many native mammalian modifications .

What experimental approaches can be used to study protein-protein interactions involving Recombinant Bovine Protein Asterix?

Investigating protein-protein interactions of Recombinant Bovine Protein Asterix requires both in vitro and cellular approaches:

In vitro methods:

  • Pull-down assays:

    • Utilize the N-terminal His-tag for nickel affinity purification

    • Incubate with potential interacting proteins or cell lysates

    • Analyze bound proteins through mass spectrometry or western blotting

  • Biophysical interaction analysis:

    • Surface Plasmon Resonance (SPR)

    • Isothermal Titration Calorimetry (ITC)

    • Microscale Thermophoresis (MST)

    • Bio-Layer Interferometry (BLI)

Cellular and in vivo methods:

  • Co-immunoprecipitation:

    • Express tagged WDR83OS in relevant cell lines

    • Immunoprecipitate using tag-specific antibodies

    • Identify co-precipitating proteins through proteomics

  • Proximity-based labeling:

    • BioID or TurboID fusion proteins to identify proximal proteins

    • APEX2 fusion for proximity-based biotinylation

    • Analysis of labeled proteins through streptavidin pull-down and mass spectrometry

  • Fluorescence-based approaches:

    • Förster Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

    • Fluorescence correlation spectroscopy (FCS)

Data interpretation considerations:

  • Compare interaction profiles across different expression systems

  • Validate key interactions through multiple orthogonal methods

  • Consider the impact of tags on potential interaction surfaces

  • Evaluate biological relevance through functional assays

These methodologies will help researchers determine potential interacting partners and elucidate the functional roles of Recombinant Bovine Protein Asterix within cellular pathways.

What are common challenges in purifying Recombinant Bovine Protein Asterix and how can they be addressed?

Purification of Recombinant Bovine Protein Asterix presents several challenges that can be addressed through systematic optimization:

Common challenges and solutions:

  • Low solubility:

    • Express at lower temperatures (16-25°C)

    • Use solubility-enhancing tags (SUMO, Thioredoxin)

    • Optimize induction conditions (IPTG concentration, induction timing)

    • Include solubility enhancers in lysis buffer (mild detergents, higher salt)

  • Protein degradation:

    • Include protease inhibitors in all buffers

    • Work at 4°C throughout purification

    • Minimize purification time

    • Add stabilizing agents like glycerol or trehalose

  • His-tag accessibility issues:

    • Consider different tag positions (C-terminal vs. N-terminal)

    • Use denaturing conditions if necessary, followed by refolding

    • Try longer linkers between tag and protein

  • Protein aggregation:

    • Screen buffer conditions (pH, salt concentration)

    • Add stabilizing agents like trehalose (as used in storage buffer)

    • Consider adding mild detergents or arginine to prevent aggregation

Optimized purification protocol:
Based on the information available for Recombinant Bovine Protein Asterix expressed with an N-terminal His-tag :

  • Resuspend bacterial pellet in lysis buffer containing:

    • 50 mM Tris-HCl pH 8.0

    • 300 mM NaCl

    • 10 mM imidazole

    • Protease inhibitor cocktail

    • 1 mg/ml lysozyme

  • Sonicate and clarify lysate by centrifugation (16,000 x g, 30 min, 4°C)

  • Perform immobilized metal affinity chromatography (IMAC):

    • Load clarified lysate onto Ni-NTA column

    • Wash with buffer containing 20-30 mM imidazole

    • Elute with buffer containing 250-300 mM imidazole

  • Perform buffer exchange to remove imidazole:

    • Dialysis against Tris/PBS-based buffer with 6% trehalose, pH 8.0

    • Alternatively, use desalting columns

  • Concentrate to desired concentration and add glycerol to 50% final concentration

  • Aliquot and store at -20°C or -80°C

How can researchers design experiments to compare the functionality of native versus recombinant Bovine Protein Asterix?

Designing robust experiments to compare native and recombinant Bovine Protein Asterix requires careful consideration of multiple parameters:

Isolation of native protein:

  • Identify appropriate bovine tissue with high WDR83OS expression

  • Develop immunoprecipitation protocol using WDR83OS-specific antibodies

  • Consider affinity purification with known interaction partners

  • Validate using western blotting and mass spectrometry

Comparative analytical approaches:

ParameterMethodologyKey Considerations
Structural integrityCircular dichroism, thermal shift assaysCompare secondary structure elements and thermal stability
Post-translational modificationsMass spectrometryIdentify differences in PTM patterns between native and recombinant forms
Binding partnersPull-down followed by proteomicsDetermine if both forms interact with the same protein partners
Functional assaysCell-based reconstitution experimentsTest ability to rescue knockout phenotypes
LocalizationImmunofluorescence microscopyCompare subcellular distribution patterns

Experimental design considerations:

  • Include multiple negative and positive controls

  • Perform experiments with biological replicates

  • Use statistical methods to quantify differences

  • Blind analysis where possible to avoid bias

Interpreting functional differences:
If differences are observed between native and recombinant forms:

  • Determine if E. coli-expressed protein lacks critical PTMs

  • Consider expression in eukaryotic systems with appropriate modifications

  • Evaluate if His-tag affects structure or function

  • Develop strategies to modify the recombinant protein to better mimic the native form

This systematic approach will help researchers understand the extent to which the recombinant protein faithfully represents the native Bovine Protein Asterix.

What are potential applications of Recombinant Bovine Protein Asterix in studying cellular processes?

Recombinant Bovine Protein Asterix has several potential applications in cellular biology research:

1. ER translocon studies:
As PAT complex subunit Asterix (Protein associated with the ER translocon) , WDR83OS can be used to:

  • Investigate protein translocation mechanisms

  • Study ER-associated degradation pathways

  • Explore quality control mechanisms for secreted proteins

2. Comparative biology applications:

  • Cross-species analysis of WDR83OS function and conservation

  • Investigation of species-specific differences in ER translocon composition

  • Understanding evolutionary adaptations in protein translocation mechanisms

3. Structural biology:

  • Crystallography studies to determine protein structure

  • Cryo-EM analysis of protein complexes involving WDR83OS

  • Structure-function relationship studies

4. Cellular stress response:

  • Investigation of WDR83OS role during ER stress

  • Analysis of protein homeostasis mechanisms

  • Studies of unfolded protein response pathways

5. Methodology development:
Similar to other recombinant proteins, WDR83OS could be used in:

  • Development of novel protein detection assays

  • Creation of research tools for studying protein-protein interactions

  • Generation of specific antibodies for research applications

These applications leverage the availability of purified recombinant protein to advance understanding of fundamental cellular processes involving the PAT complex and ER translocon.

How might CRISPR/Cas9 genome editing be used to study the function of endogenous Bovine Protein Asterix?

CRISPR/Cas9 technology offers powerful approaches to investigate endogenous WDR83OS function:

Knockout studies:

  • Design guide RNAs targeting bovine WDR83OS gene

  • Generate knockout cell lines or animal models

  • Characterize phenotypes:

    • ER stress response alterations

    • Protein translocation defects

    • Changes in cellular proteostasis

    • Growth and developmental abnormalities

Knock-in approaches:

  • Endogenous tagging:

    • Insert fluorescent protein tags for live-cell imaging

    • Add affinity tags for pulldown experiments

    • Introduce proximity labeling tags to identify interacting proteins

  • Point mutations:

    • Introduce specific mutations to study structure-function relationships

    • Create disease-relevant variants

Expression modulation:

  • CRISPRi/CRISPRa:

    • Use deactivated Cas9 fused to repressors/activators

    • Modulate WDR83OS expression without altering the genomic sequence

    • Study dose-dependent effects

  • Inducible systems:

    • Create conditional knockout systems

    • Develop temporally controlled expression systems

Implementation strategies:
Similar to approaches described for other systems , researchers can:

  • Use site-specific genome editing in bovine cell lines

  • Apply CRISPR/Cas9 RNP complex delivery through lipofection

  • Consider species-specific optimization of guide RNA design

These CRISPR/Cas9 approaches can provide insights into WDR83OS function that complement studies using recombinant protein, offering a more comprehensive understanding of its biological roles.

What considerations should be made when designing antibodies against Recombinant Bovine Protein Asterix?

Designing effective antibodies against Recombinant Bovine Protein Asterix requires strategic planning:

Epitope selection considerations:

  • Sequence analysis:

    • Identify unique regions specific to WDR83OS

    • Avoid highly conserved regions if species specificity is desired

    • Consider solvent-exposed regions based on structural predictions

  • Cross-reactivity assessment:

    • Evaluate sequence homology across species

    • Determine if antibody should recognize orthologs from multiple species

    • Consider potential cross-reactivity with related proteins

Antibody format selection:

  • Polyclonal antibodies:

    • Advantages: Multiple epitope recognition, robust signal

    • Considerations: Batch-to-batch variability, potential cross-reactivity

    • Best for: Initial characterization, immunoprecipitation

  • Monoclonal antibodies:

    • Advantages: Consistency, specificity to single epitope

    • Considerations: More resource-intensive to develop

    • Best for: Specific applications requiring high reproducibility

  • Recombinant antibodies:

    • Advantages: Consistent production, potential for engineering

    • Considerations: Technical expertise required

    • Best for: Long-term research programs, therapeutic development

Validation strategies:

  • Western blot against:

    • Recombinant WDR83OS protein

    • Native protein from bovine tissues

    • Lysates from cells with WDR83OS knockdown/knockout

  • Immunoprecipitation followed by mass spectrometry

  • Immunofluorescence with proper controls:

    • WDR83OS overexpression

    • siRNA knockdown

    • Peptide competition

This systematic approach to antibody development will yield valuable research tools for studying Bovine Protein Asterix in various experimental contexts.

What are the current limitations in research on Recombinant Bovine Protein Asterix and future directions to address them?

Current limitations in WDR83OS research include:

  • Limited functional characterization:

    • Precise cellular functions not fully elucidated

    • Interacting partners not comprehensively identified

    • Regulatory mechanisms poorly understood

  • Expression system constraints:

    • Current E. coli expression may not recapitulate native PTMs

    • Potential structural differences between recombinant and native forms

    • Optimization for higher yields needed

  • Methodological challenges:

    • Limited availability of specific antibodies

    • Lack of standardized functional assays

    • Few animal models for in vivo studies

Future research directions:

  • Comprehensive structural studies:

    • Determine high-resolution structure using X-ray crystallography or cryo-EM

    • Characterize conformational changes upon complex formation

    • Identify functional domains through structure-function analysis

  • Expression system optimization:

    • Implement CRISPR/Cas9 technologies for enhanced expression

    • Explore alternative eukaryotic expression systems

    • Develop strategies for producing protein with native PTMs

  • Interaction network mapping:

    • Apply proximity labeling approaches in relevant cell types

    • Characterize dynamic interactions under various cellular conditions

    • Validate key interactions through multiple orthogonal methods

  • Functional genomics:

    • Generate knockout models using CRISPR/Cas9

    • Perform comprehensive phenotypic analysis

    • Conduct rescue experiments with wild-type and mutant forms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.