Recombinant Bovine Protein ATP1B4 (ATP1B4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ATP1B4; Protein ATP1B4; X,K-ATPase subunit beta-m; X/potassium-transporting ATPase subunit beta-m
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MRRQLRSRRAPALPYGYRYRLDDQDEVNQNYLADEEEEAEEEARVMVVPDLEEEEEEEEE KEEEEKEEEDSHSQETDSAWWRKLQIVNEYLWDPEKRTSLARTGQSWSLILVIYFFFYAS LAAVITLCMYTLFLTISPYMPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVISL NGFLQGYNDSLQEEMNVDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYST GQPCILLKMNRIVGFRPERGDPVKVSCKVQRGDENDIRSINYYPESASFDLRYYPYYGKL THVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIINDVINDRFVGRVIFTLNIET
Uniprot No.

Target Background

Function
May function as a transcriptional coregulator during muscle development via interaction with SNW1. It has lost its ancestral role as a Na,K-ATPase beta-subunit.
Database Links
Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Nucleus inner membrane; Single-pass type II membrane protein.

Q&A

What is the function of ATP1B4 in bovine systems compared to human counterparts?

ATP1B4 in bovine systems, like in humans, has evolved away from its ancestral role as a Na,K-ATPase beta-subunit and instead functions primarily as a transcriptional coregulator in muscle development pathways . To study functional differences between bovine and human ATP1B4:

  • Implement comparative sequence analysis using alignment tools (CLUSTAL, MUSCLE) to identify conserved domains and species-specific variations

  • Conduct co-immunoprecipitation experiments with bovine and human ATP1B4 using SNW1 as bait to quantify interaction strength differences

  • Perform reporter gene assays with muscle-specific promoters to measure transcriptional effects in both species

  • Use tissue-specific RNA-seq analysis to compare expression patterns across developmental stages

The loss of Na,K-ATPase beta-subunit function appears consistent across species, but the degree of transcriptional coregulation activity may vary based on species-specific muscle development requirements .

What expression systems are most effective for producing recombinant bovine ATP1B4?

Multiple expression systems have been validated for recombinant bovine ATP1B4 production, each with distinct advantages depending on research requirements :

Expression SystemAdvantagesLimitationsRecommended Application
E. coliHigh yield, cost-effective, rapid productionLimited post-translational modifications, potential inclusion bodiesStructural studies, antibody production, interaction assays
BaculovirusBetter folding than bacterial systems, moderate PTMsMore complex than E. coli, moderate costFunctional studies requiring some PTMs
Mammalian cellNative-like post-translational modifications, proper foldingLower yield, higher cost, longer production timeFunctional assays, cell-based assays, PTM studies
In Vivo BiotinylationSite-specific labeling for detection/purificationSpecialized vectors requiredPull-down assays, protein-protein interaction studies

For studies focused on transcriptional coregulator function, mammalian expression systems are recommended as they maintain appropriate nuclear localization signals and relevant post-translational modifications needed for protein-protein interactions with transcription factors .

How can researchers verify the activity and integrity of recombinant bovine ATP1B4?

A multi-faceted approach is necessary to confirm both structural integrity and functional activity:

  • Structural Integrity Verification:

    • SDS-PAGE with Coomassie staining to assess purity and expected molecular weight

    • Western blot analysis using anti-ATP1B4 antibodies to confirm identity

    • Circular dichroism spectroscopy to evaluate secondary structure elements

    • Limited proteolysis to assess proper folding

  • Functional Activity Assessment:

    • Co-immunoprecipitation with known binding partners (especially SNW1)

    • Electrophoretic mobility shift assays (EMSA) to assess DNA-binding capability when complexed with transcription factors

    • Reporter gene assays using muscle-specific promoters to measure transcriptional coregulation

Comparing activity metrics between fresh preparations and stored samples provides valuable stability data for optimization of experimental protocols .

What experimental controls are essential when studying ATP1B4 protein-protein interactions?

When investigating ATP1B4 interactions, particularly with its known partner SNW1, implement these critical controls:

  • Negative Controls:

    • Non-interacting protein of similar size/charge properties

    • ATP1B4 with mutations in predicted interaction domains

    • Competition assays with excess unlabeled protein

  • Positive Controls:

    • Known interaction partners validated in previous studies

    • Different tags/fusion proteins to ensure tag isn't driving interaction

    • Concentration gradients to establish binding kinetics

  • Validation Approaches:

    • Implement at least two orthogonal interaction methods (e.g., co-IP and FRET)

    • Perform reciprocal pull-downs (ATP1B4 as bait, then SNW1 as bait)

    • Use deletion constructs to map minimal interaction domains

These controls help distinguish specific biological interactions from technical artifacts or non-specific binding .

How does mitochondrial stress affect ATP1B4 expression and function?

Recent multi-omics research has shown that mitochondrial stress activates the integrated stress response (ISR) pathway through ATF4, which can modulate numerous cellular proteins including those involved in transcriptional regulation . To investigate ATP1B4 in this context:

  • Experimental Approaches:

    • Subject cells expressing bovine ATP1B4 to mitochondrial stressors (OXPHOS inhibitors, mtDNA depletion)

    • Perform RNA-seq and proteomics analysis to track ATP1B4 expression changes

    • Use ChIP-seq to identify if ATF4 directly regulates ATP1B4 promoter

    • Implement ATF4 knockdown/overexpression to determine direct regulatory relationships

  • Data Analysis Strategy:

    • Correlate ATP1B4 expression with ATF4 levels and ISR markers

    • Compare ATP1B4 subcellular localization before and after mitochondrial stress

    • Assess changes in ATP1B4-SNW1 interaction during stress response

This research direction is particularly relevant as ATF4 has been identified as a key regulator of the mitochondrial stress response, potentially influencing transcriptional coregulators like ATP1B4 .

What are the key challenges in crystallizing bovine ATP1B4 for structural studies?

Obtaining high-resolution structural data for bovine ATP1B4 presents several challenges:

Successful structural determination would significantly advance understanding of how ATP1B4 functions as a transcriptional coregulator and how it differs from conventional Na,K-ATPase beta-subunits .

How can researchers effectively study the evolution of ATP1B4's functional shift?

To investigate ATP1B4's evolutionary transition from Na,K-ATPase beta-subunit to transcriptional coregulator:

  • Comparative Genomics Approach:

    • Sequence ATP1B4 homologs across diverse vertebrate species

    • Identify key substitutions correlating with functional change

    • Calculate selection pressures (dN/dS ratios) on different protein domains

    • Construct ancestral sequence reconstructions for functional testing

  • Experimental Validation:

    • Generate chimeric proteins between ATP1B4 and conventional beta-subunits

    • Test Na,K-ATPase assembly competence of various constructs

    • Assess transcriptional coregulator function across chimeras

    • Introduce ancestral/derived mutations to pinpoint critical functional switches

  • Data Integration Framework:

    • Map evolutionary changes to structural models

    • Correlate functional changes with species developmental patterns

    • Analyze tissue expression patterns across evolutionary lineages

This evolutionary approach provides insight into how proteins can be repurposed for new cellular functions and identifies critical residues determining functional specificity .

What are the optimal methods for investigating ATP1B4 post-translational modifications?

Post-translational modifications (PTMs) likely regulate ATP1B4's transcriptional coregulator function. A comprehensive PTM mapping strategy includes:

  • Detection Methods:

    • Mass spectrometry approaches:

      • Bottom-up proteomics with enrichment for specific PTMs

      • Middle-down approaches for combinatorial PTM analysis

      • Top-down proteomics for intact protein analysis

    • Western blotting with PTM-specific antibodies

    • Radiolabeling for dynamic PTM turnover studies

  • Functional Validation:

    • Site-directed mutagenesis of modified residues

    • Treatment with PTM-modifying enzymes or inhibitors

    • Correlation of PTM status with transcriptional activity

    • Assessment of PTM impact on protein-protein interactions

  • Comparative PTM Analysis:

    PTM TypeDetection MethodFunctional SignificanceAnalytical Challenges
    PhosphorylationPhospho-enrichment + MS/MSRegulates protein interactions, subcellular localizationMultiple isoforms, stoichiometry
    AcetylationAntibody-based enrichment + MSModulates DNA binding, protein stabilityLow abundance, labile modifications
    UbiquitinationK-ε-GG enrichment + MSRegulates protein turnover, complex assemblyProteolytic requirements, branched peptides
    SUMOylationSUMO-remnant enrichmentAlters transcriptional activityLow stoichiometry, specialized protocols

Understanding the PTM landscape of ATP1B4 is crucial for fully characterizing its regulation as a transcriptional coregulator in different cellular contexts .

What approaches should be used to investigate ATP1B4's role in mitochondrial disease models?

Given the emerging connections between transcriptional regulators and mitochondrial function highlighted in recent multi-omics studies , investigating ATP1B4 in mitochondrial disease contexts requires:

  • Disease Model Systems:

    • Patient-derived fibroblasts from mitochondrial disease cases

    • CRISPR-engineered cellular models with mitochondrial mutations

    • Tissue-specific ATP1B4 knockout/overexpression animal models

    • Induced pluripotent stem cells differentiated to affected tissues

  • Analytical Framework:

    • Integrate transcriptomics, proteomics, and metabolomics data

    • Map ATP1B4-dependent transcriptional networks in normal vs. disease states

    • Use proximity labeling to identify stress-induced protein interactions

    • Implement mitochondrial functional assays (respiration, membrane potential)

  • Therapeutic Exploration:

    • Screen compounds that modulate ATP1B4 activity or expression

    • Assess ATP1B4 pathway as biomarker for disease progression

    • Evaluate genetic compensation mechanisms in ATP1B4-deficient systems

This research direction could potentially identify ATP1B4 as a novel therapeutic target or biomarker in mitochondrial disease contexts, particularly in muscle-related pathologies where its transcriptional coregulator function may be most relevant .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.