Recombinant Bovine Protein CNPPD1 (CNPPD1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, briefly centrifuge the vial to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.

The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize its development.

Synonyms
CNPPD1; Protein CNPPD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-411
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CNPPD1
Target Protein Sequence
MDLAGLLLDEEGTFSLTGFQDFTFLPGHQKLSARIRRRLYYGWDWETDCTLEELSSPVAD IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWRLYTDPRE IFEVLSWLEGCVAEQQGRRRGWYTYTDLCVLLEQPAWQLVLGSLCQQLAKLSCLLAMAYV SSVALAVASMAVIHQSLGLSCSPPPGPPDLGLASRCLLEPCIPSPMPQCLPSPANASGCL EGNVVLRSLWGSLLVSLTPPPLPPPDPPAPPILLHNCPLCQKLQKDSPTCRACHHLNHTV PTGPPSPWSHSHGLAPPWPWSPMPPLLPQPQQCSLFSIMELARLKSFIFPG
Uniprot No.

Target Background

Database Links

KEGG: bta:507473

STRING: 9913.ENSBTAP00000016753

UniGene: Bt.4477

Protein Families
CNPPD1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is CNPPD1 and what are its key structural and functional properties?

CNPPD1 (Cyclin Pas1/PHO80 Domain Containing 1) is a 410 amino acid single-pass membrane protein. The human ortholog is encoded by a gene located on chromosome 2q35. CNPPD1 is predicted to enable cyclin-dependent protein serine/threonine kinase regulator activity and is involved in the regulation of cyclin-dependent protein serine/threonine kinase activity .

Current structural knowledge indicates that CNPPD1:

  • Is an integral component of membrane

  • Functions as part of cyclin-dependent protein kinase holoenzyme complex

  • Is primarily active in the nucleus

  • Contains specific protein kinase binding domains

While much of the research has focused on human CNPPD1, the bovine ortholog likely shares significant structural and functional similarities, as cyclin-dependent kinase regulatory proteins are often conserved across mammalian species.

  • What methods are commonly used for detecting and quantifying CNPPD1 expression?

Multiple methodologies can be employed for detecting CNPPD1, with selection depending on specific research objectives:

Protein Detection Methods:

  • Immunohistochemistry: Validated CNPPD1 antibodies can be used at dilutions of 1:50-1:200 for paraffin-embedded tissues

  • Western Blotting: Using specific antibodies like those validated against 383 other non-specific proteins

  • Mass Spectrometry: Both intensity-based and spectral count-based approaches can be employed

Gene Expression Analysis:

  • RT-PCR/qPCR: For mRNA quantification. Primer design should target conserved regions between human and bovine sequences

  • Northern Blotting: For detecting transcript size and abundance

  • RNA-Seq: For comprehensive transcriptome analysis

For protein quantification via mass spectrometry, consider these approaches :

  • Use both apex (intensity at peak height) and area (area under curve) measurements

  • Normalize peptide intensities by dividing by the sum of all peptide intensities in the LC-MS run

  • Calculate protein-level expression by either summing the three largest peptide intensities or summing all peptides and normalizing by protein length

  • What gene expression patterns correlate with CNPPD1?

Expression correlation studies in model organisms have identified genes with significant positive and negative correlations with CNPPD1. For example, in zebrafish, the following correlation patterns were observed :

Table 1: Top Genes Positively Correlated with CNPPD1

GeneCorrelation Coefficient (r)
cast0.115
spint20.114
lye0.110
aldob0.107
cd9b0.107

Table 2: Top Genes Negatively Correlated with CNPPD1

GeneCorrelation Coefficient (r)
stmn1b-0.100
rtn1a-0.098
elavl3-0.096
tuba1c-0.095
gng3-0.092

These correlation patterns suggest CNPPD1 may have functional relationships with genes involved in cytoskeletal organization, metabolism, and membrane processes. When studying bovine CNPPD1, researchers should consider examining orthologous genes to identify conserved functional relationships.

Advanced Research Questions

  • What are the optimal expression systems and conditions for producing recombinant bovine CNPPD1?

The choice of expression system for recombinant bovine CNPPD1 should be based on research requirements for protein yield, post-translational modifications, and downstream applications:

Expression System Comparison:

SystemAdvantagesDisadvantagesRecommended Conditions
E. coliHigh yield, rapid growth, cost-effectiveLimited post-translational modifications, potential inclusion body formationBL21(DE3) strain, induction at OD600 0.6-0.8, 16-20°C induction for membrane proteins
P. pastorisEukaryotic processing, high-density growth, protein secretionLonger production time, complex methanol induction22°C, pH 6, 1% (v/v) methanol induction, maximum activity at 96h post-induction
Mammalian cellsAuthentic post-translational modifications, proper foldingHigher cost, lower yields, complex media requirementsHEK293 or CHO cells, serum-free adapted lines for scale-up

For E. coli expression, fusion tags significantly impact recombinant protein production. In a study with a different recombinant protein, the SUMO fusion tag yielded detectable expression bands at the expected molecular weight (71 kDa) .

For P. pastoris expression, implementing CRISPR/Cas9 technology can enhance integration efficiency approaching 100% when using ku70 deletion strains, enabling markerless genome modifications for expression optimization .

  • How can experimental design approaches be optimized for studying bovine CNPPD1 interactions?

For robust interaction studies of bovine CNPPD1, multivariant analysis approaches provide significantly more information than traditional univariant methods:

Key Experimental Design Principles:

  • Multivariant Analysis: Evaluate responses by changing multiple variables simultaneously to estimate statistically significant factors and their interactions

    • Enables characterization of experimental error

    • Allows comparison of variable effects when normalized

    • Provides high-quality information with fewer experiments

  • Parameter Optimization: For expression studies, investigate critical parameters simultaneously:

    • Temperature (range: 16-30°C)

    • Inducer concentration

    • Media composition

    • Harvest timing

When prior information exists about potential CNPPD1 interactions, the proposed psgMCP approach from Zhang et al. demonstrates superior performance compared to alternatives when integrating existing knowledge with new experimental data .

  • How can gene editing techniques be applied to study bovine CNPPD1 function?

CRISPR/Cas9 offers powerful approaches for studying bovine CNPPD1 function through various genetic modifications:

CRISPR/Cas9 Applications for CNPPD1 Studies:

  • Gene Knockout: Generate complete CNPPD1 knockouts to study loss-of-function phenotypes

    • Design guide RNAs targeting early exons or critical functional domains

    • Use HDR templates with selection markers for efficient knockout screening

  • Domain Engineering: Create precise modifications to study specific protein domains

    • Design HDR templates to introduce specific mutations or domain deletions

    • Prioritize modifications to the cyclin Pas1/PHO80 domain to assess kinase regulatory functions

  • Regulatory Element Analysis: Modify enhancers and promoters to study CNPPD1 regulation

    • Multipartite enhancer clusters may control tissue-specific expression through additive effects

    • Deletions of enhancer regions can result in growth defects, while duplications can cause dose-dependent upregulation

  • Tagging Strategies: Insert reporter tags for localization and interaction studies

    • C-terminal tags are preferable given the predicted membrane topology of CNPPD1

    • Consider split fluorescent protein systems for interaction studies

In yeast systems, CRISPR/Cas9 has achieved site-specific gene integration with efficiencies approaching 100% . Similar approaches can be adapted for mammalian cell studies of bovine CNPPD1.

  • How can purification strategies be optimized for recombinant bovine CNPPD1?

Purification of recombinant membrane proteins like CNPPD1 requires carefully optimized protocols:

Recommended Purification Workflow:

  • Cell Lysis and Membrane Fraction Isolation:

    • For membrane proteins, gentle lysis methods are preferable

    • Differential centrifugation to isolate membrane fractions (100,000×g ultracentrifugation)

    • Detergent screening panel to identify optimal solubilization conditions

  • Affinity Chromatography:

    • His-tag purification using Ni-NTA resin if expressing with N/C-terminal His-tag

    • Consider using dual affinity tags (His + additional tag) for increased purity

    • Optimize imidazole concentrations for washing and elution steps

  • Secondary Purification:

    • Ion exchange chromatography based on predicted isoelectric point

    • Size exclusion chromatography for final polishing and buffer exchange

    • Blue Native PAGE to assess oligomeric state

  • Stability Enhancement:

    • Store at 4°C short term (as recommended for CNPPD1 antibodies)

    • For long-term storage, aliquot and store at -20°C

    • Avoid freeze-thaw cycles

    • Consider adding 40% glycerol with 0.02% sodium azide for long-term stability

Detergent selection is critical for membrane protein purification. Test panels including DDM, LMNG, and digitonin at various concentrations to maximize functional protein recovery.

  • How can contradictory data about CNPPD1 function be reconciled?

Contradictory findings about CNPPD1 function should be evaluated through systematic analysis of experimental variables:

Reconciliation Strategy:

  • Sample Size and Power Analysis:

    • Ensure adequate sample size to achieve sufficient statistical power

    • For microarray or high-throughput studies, this is particularly critical given the multiple testing burden

  • Source of Variation Assessment:

    • Biological variation (disease state, sex, age, genetic background)

    • Technical variation (platform differences, sample preparation)

    • When inter-individual variability is the main contributor, increase independent biological samples rather than technical replicates

  • Data Integration Approaches:

    • Meta-analysis of multiple datasets

    • Bayesian integration frameworks that weight evidence based on study quality

    • Network analysis to identify consistent patterns despite individual data point variations

  • Experimental Validation:

    • Validate key findings using orthogonal techniques

    • Replicate critical experiments in different model systems

    • Focus on consistent functional patterns rather than individual measurements

Researchers should note that even for well-studied proteins, gene expression and protein abundance often show non-negligible correlation with technical factors like protein length, which may introduce systematic biases in quantitative analyses .

  • How can post-translational modifications of bovine CNPPD1 be characterized?

Post-translational modifications (PTMs) of CNPPD1 may significantly impact its function and interactions:

PTM Characterization Methods:

  • Mass Spectrometry Approaches:

    • Enrichment strategies for specific PTMs (phosphorylation, glycosylation)

    • MS/MS fragmentation to identify exact modification sites

    • Quantitative approaches to determine stoichiometry of modifications

    • Consider both intensity-based and spectral count-based methods for quantification

  • Site-Directed Mutagenesis:

    • Create alanine substitutions at predicted modification sites

    • Compare functional outcomes between wild-type and mutant proteins

    • Employ phosphomimetic mutations (S/T→D/E) to study phosphorylation effects

  • Specific Antibodies:

    • Generate or source antibodies against specific PTM forms of CNPPD1

    • Use for western blotting, immunoprecipitation, and immunohistochemistry

    • Validate specificity using appropriate controls (e.g., phosphatase treatment)

  • In Vitro Enzymatic Assays:

    • Identify kinases/phosphatases that act on CNPPD1

    • Study glycosyltransferases that may modify CNPPD1

    • Establish functional consequences of enzymatic modifications

For DNA methylation studies relevant to CNPPD1 regulation, use a 1-kb sliding window analysis rather than focusing on isolated changes in individual CpGs, as regulatory methylation changes generally encompass multiple CpGs .

  • What expression optimization strategies can enhance recombinant bovine CNPPD1 yield?

Maximizing recombinant CNPPD1 yield requires comprehensive optimization of expression parameters:

Yield Enhancement Strategies:

  • Promoter Optimization:

    • Test multiple promoters individually and in stacked configurations

    • In a study with bovine lysozyme, stacked triple promoter configurations achieved 2.0-8.6 fold higher protein yield compared to single promoter systems

    Table 3: Yield Comparison with Different Promoter Configurations (Example from Bovine Lysozyme Study)

    LineGene Copy NumberProtein Yield (mg/kg)% of Total Soluble Protein
    Single promoter10.0-15.00.5-0.70.07-0.1
    Dual promoter8.0-25.00.5-0.70.07-0.1
    Triple promoter12.0-31.01.0-6.00.1-0.8
  • Codon Optimization:

    • Adapt codon usage to expression host preferences

    • Avoid rare codons, especially in critical regions

    • Optimize GC content and mRNA secondary structure

  • Gene Copy Number:

    • Determine optimal gene copy number through qPCR analysis

    • Assess correlation between copy number and protein yield

    • For some recombinant proteins, 6-7 gene copies provide optimal expression levels

  • Truncation Strategies:

    • Consider domain-based truncations to improve expression

    • In some cases, removal of C-terminal domains (like Por secretion tail) can enhance expression without affecting function

    • Analyze transcription levels of full-length vs. truncated constructs via qPCR

  • Secretion Signal Optimization:

    • For P. pastoris expression, the α-factor signal peptide can promote efficient secretion

    • When using secretion vectors, C-terminal secretion tails may be unnecessary

For P. pastoris expression specifically, methanol induction timing is critical - in studies with other recombinant proteins, enzymatic activity was first detected after 24h with methanol addition, and peaked after 96h of incubation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.