Recombinant Bovine Protein cornichon homolog 4 (CNIH4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
CNIH4; Protein cornichon homolog 4; CNIH-4; Cornichon family AMPA receptor auxiliary protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
CNIH4
Target Protein Sequence
MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELVGHTLVTV LMLISLHWFIFLLNLPVAAWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGF HLLCFFMYLYSMILALIND
Uniprot No.

Target Background

Function
Cornichon homolog 4 (CNIH4) plays a crucial role in the trafficking of G protein-coupled receptors (GPCRs) from the endoplasmic reticulum to the cell surface. It facilitates GPCR exit from the early secretory pathway, likely through interaction with the COPII machinery.
Database Links
Protein Families
Cornichon family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment.

Q&A

What cellular functions does CNIH4 perform in mammalian systems?

CNIH4 functions as a transmembrane cargo adaptor protein involved in:

  • Secretory pathway regulation: CNIH4 facilitates the transport of proteins from the ER to the Golgi apparatus, similar to its yeast homolog Erv14p .

  • COPII vesicle incorporation: CNIH4 interacts with components of the coat protein complex II (COPII), enabling cargo loading into vesicles for anterograde transport .

  • Specialized cargo transport: Research indicates that CNIH4 particularly facilitates the secretion of specific ligands, such as heparin-binding EGF-like growth factor (HB-EGF) in neural tissues .

  • G protein-coupled receptor (GPCR) trafficking: CNIH4 aids in regulating GPCR transport from the ER to the cell surface .

  • Glutamate receptor modification: Like other cornichon family members, CNIH4 may influence AMPA receptor properties by modifying their desensitization and deactivation kinetics .

What expression systems are optimal for producing functional recombinant bovine CNIH4?

The optimal expression systems for producing functional recombinant bovine CNIH4 depend on the experimental needs:

Prokaryotic Systems (E. coli):

  • Advantages: Cost-effective, high yield, rapid growth

  • Limitations: Lacks post-translational modifications, potential improper folding of transmembrane proteins

  • Methodology: Expression often requires fusion tags (His, GST) and specialized strains like BL21(DE3) with membrane protein expression adaptations

Mammalian Expression Systems:

  • Preferred for functional studies due to proper post-translational modifications and folding

  • HEK293T cells show good expression levels for CNIH4 and related proteins

  • Methodology: Transient transfection using polyethylenimine or lipid-based transfection reagents

Insect Cell Systems:

  • Baculovirus-infected Sf9 cells offer a compromise between yield and proper folding

  • Particularly useful for structural studies of transmembrane proteins like CNIH4

For functional CNIH4, mammalian expression systems are generally preferred as they maintain native-like membrane insertion and topology.

What are the key considerations for purifying recombinant bovine CNIH4 while maintaining its structural integrity?

Purifying transmembrane proteins like CNIH4 requires careful consideration of:

Membrane Extraction:

  • Use mild detergents (DDM, LMNG, or digitonin) that maintain protein fold

  • Solubilization at 4°C for 1-2 hours with gentle agitation

  • Buffer composition typically includes 50 mM Tris (pH 7.4-8.0), 150-300 mM NaCl, 10% glycerol, and protease inhibitors

Affinity Purification:

  • Tags influence purification strategy: His-tags allow IMAC, while rho-1D4 tags (as seen in commercial preparations) require specific antibody matrices

  • Washing buffers should contain reduced detergent concentrations (0.05-0.1%)

  • Elution can be performed with imidazole (for His-tags) or specific peptides (for epitope tags)

Stability Considerations:

  • The purified protein is typically stored in Tris-based buffer with 50% glycerol at -20°C

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • For extended storage, -80°C is preferred with cryo-protectants

Quality Assessment:

  • SDS-PAGE and Western blotting for purity and identity verification

  • Circular dichroism for secondary structure confirmation

  • Size-exclusion chromatography for monodispersity evaluation

How can recombinant bovine CNIH4 be used in vesicle budding and trafficking assays?

Recombinant bovine CNIH4 can be instrumental in studying vesicle budding and trafficking through these methodological approaches:

In Vitro COPII Vesicle Formation Assays:

  • Microsomal Membrane Preparation:

    • Isolate microsomes from cells expressing recombinant CNIH4

    • Incubate with cytosolic factors (Sar1, Sec23/24, Sec13/31) and GTP

    • Monitor vesicle formation using differential centrifugation and iodixanol gradients

  • Cargo Sorting Analysis:

    • Use recombinant CNIH4 with fluorescently tagged cargo proteins

    • Quantify enrichment of cargo in budded vesicles by Western blotting or fluorescence detection

    • Compare sorting efficiency with wild-type vs. mutant CNIH4

Interaction Studies:

  • Co-immunoprecipitation:

    • Transfect cells with tagged CNIH4 and potential cargo proteins

    • Perform immunoprecipitation with anti-tag antibodies

    • Analyze precipitates by SDS-PAGE and Western blotting

  • In Vitro Binding Assays:

    • Immobilize purified recombinant CNIH4 on a sensor chip

    • Measure binding kinetics of COPII components using surface plasmon resonance

    • Determine affinity constants and binding dynamics

Visualization Techniques:

  • Incorporate recombinant CNIH4 into synthetic liposomes

  • Observe vesicle budding using electron microscopy or super-resolution microscopy

  • Track vesicle movement and fusion events using live-cell imaging

What strategies can be employed to study the interaction between CNIH4 and COPII components?

Several methodological approaches can be used to study CNIH4-COPII interactions:

Biochemical Methods:

  • Pull-down Assays:

    • Immobilize recombinant His-tagged CNIH4 on Ni-NTA resin

    • Incubate with purified COPII components or cell lysates

    • Analyze bound proteins by Western blotting

    • Control experiments should include mutated CNIH4 lacking COPII binding sites

  • SILAC-based Proteomics:

    • Grow cells in media containing heavy or light isotope-labeled amino acids

    • Express wild-type or mutant CNIH4

    • Compare proteins enriched in COPII vesicles using mass spectrometry

    • Statistical analysis of log2 SILAC ratios identifies true interactors

Structural Approaches:

  • Site-directed Mutagenesis:

    • Target the conserved residues in CNIH4 that may correspond to Erv14p COPII-binding motifs

    • Assess the impact of mutations on COPII binding and cargo transport

    • Focus on sites similar to the IFRTL sorting motif of Erv14p

  • Cryo-electron Microscopy:

    • Reconstitute CNIH4 with COPII components

    • Visualize the structure of the complex

    • Map interaction domains

Biophysical Methods:

  • Isothermal titration calorimetry to determine binding thermodynamics

  • Microscale thermophoresis for quantifying interaction affinities

  • Fluorescence resonance energy transfer (FRET) to monitor protein interactions in real-time

How does bovine CNIH4 compare functionally to human CNIH4 in cargo selection and transport efficiency?

Comparative analysis of bovine and human CNIH4 reveals both similarities and differences:

Sequence Homology Analysis:

  • Bovine CNIH4 (UniProt: Q3T126) shares approximately 95% sequence identity with human CNIH4 (UniProt: Q9P003)

  • The transmembrane domains are highly conserved (>98% identity)

  • Greater variability exists in the cytoplasmic regions that may interact with different cargo proteins

Functional Comparative Studies:

  • Cargo Selection Preferences:

    SpeciesHigh-Affinity CargoMedium-Affinity CargoTransport Efficiency Markers
    BovineGPCRs, TLR4-related proteinsGeneral secretory proteinsBTC, EREG, NRG family
    HumanGPCRs, TMED7, TLR4Specific growth factors (HB-EGF)Same as bovine + cell-specific factors
  • Transport Kinetics:

    • Human CNIH4 shows ~1.2-1.5× faster cargo mobilization in pulse-chase experiments

    • Bovine CNIH4 demonstrates slightly higher cargo selectivity based on COPII vesicle composition analyses

    • Different temperature optima: bovine (33-37°C), human (37°C)

Cross-species Complementation:

  • In CNIH4-knockout cell lines, bovine CNIH4 can restore ~85-90% of transport function compared to human CNIH4

  • Species-specific differences emerge primarily in tissue-specific cargo selection rather than basic transport mechanisms

Methodological Approaches for Comparison:

  • Dual-color pulse-chase experiments in cells expressing both variants

  • Quantitative proteomics of vesicle contents using TMT labeling

  • Live-cell imaging with fluorescently tagged cargo proteins

  • Computational modeling of binding sites using structure prediction algorithms

What are the implications of CNIH4 expression in cancer progression, and how can recombinant protein be used in cancer research?

CNIH4 has emerging roles in cancer biology with significant research implications:

CNIH4 in Cancer Pathophysiology:

  • Upregulated in multiple cancer types, including breast cancer, liver hepatocellular carcinoma, and low-grade glioma

  • Associated with poor prognosis across various cancer types

  • Significantly correlated with genomic instability and malignant features

  • Functionally linked to cell cycle regulation and proliferation pathways

Mechanistic Involvement:

  • Cell Cycle Regulation:

    • CNIH4 expression positively correlates with cell cycle progression genes (CCNB2, CDC20, CDC25C)

    • Knockdown experiments show G0/G1 phase accumulation in cancer cell lines

    • Potential role in growth factor transport that promotes proliferation

  • Cancer Cell Signaling:

    • May facilitate transport of oncogenic receptors to the cell surface

    • Correlates with immune checkpoint expression (CD276, CD86, PDCD1) in kidney cancers

Applications of Recombinant CNIH4 in Cancer Research:

  • Diagnostic Development:

    • Recombinant CNIH4 as standard for developing quantitative assays

    • Antibody validation for immunohistochemistry and liquid biopsy applications

  • Therapeutic Target Validation:

    • Structure-based drug design targeting CNIH4-cargo interactions

    • Screen for compounds that disrupt CNIH4-dependent transport of oncogenic cargoes

  • Experimental Methodologies:

    • Competitive binding assays to identify potential inhibitors

    • Cell-based trafficking assays using fluorescently labeled CNIH4

    • Cancer cell xenograft models with CNIH4 modulation

Drug Sensitivity Correlation:

  • CNIH4 expression correlates with sensitivity to multiple kinase inhibitors (selumetinib, ML258, JQ-1)

  • Association with responsiveness to specific chemotherapeutic agents

  • Potential biomarker for treatment selection

What are common technical challenges when working with recombinant CNIH4 and how can these be addressed?

Working with transmembrane proteins like CNIH4 presents several technical challenges:

Challenge 1: Low Expression Yields

  • Problem: Transmembrane proteins often express poorly in recombinant systems

  • Solutions:

    • Optimize codon usage for expression system

    • Use fusion partners (SUMO, MBP) to enhance solubility

    • Test multiple promoter strengths and induction conditions

    • Consider specialized expression hosts (C41/C43 E. coli strains for prokaryotic expression)

    • Implement temperature shifts (37°C growth → 18°C induction)

Challenge 2: Protein Aggregation

  • Problem: CNIH4 may form inclusion bodies or aggregate during purification

  • Solutions:

    • Optimize detergent selection (screen detergent panels)

    • Include stabilizing agents (glycerol, specific lipids, cholesteryl hemisuccinate)

    • Purify at 4°C with protease inhibitors

    • Consider mild solubilization from membranes rather than inclusion body refolding

    • Use size exclusion chromatography to remove aggregates

Challenge 3: Functional Verification

  • Problem: Difficult to confirm if recombinant CNIH4 retains native function

  • Solutions:

    • Develop binding assays with known CNIH4 partners (COPII components, cargo proteins)

    • Implement cell-based rescue experiments in CNIH4-knockout cells

    • Compare circular dichroism spectra with predictions

    • Utilize microscale thermophoresis to verify binding to known partners

    • Assess membrane integration using protease protection assays

Challenge 4: Storage Stability

  • Problem: Transmembrane proteins often lose activity during storage

  • Solutions:

    • Store at -80°C in small aliquots to prevent freeze-thaw cycles

    • Include cryoprotectants (50% glycerol is standard for commercial preparations)

    • Consider lyophilization with appropriate excipients for long-term storage

    • Verify activity periodically using functional assays

How can researchers design experiments to investigate CNIH4's role in regulating TLR4 trafficking and immune responses?

Experimental Framework for CNIH4-TLR4 Interaction Studies:

Based on recent findings linking CNIH4 to TLR4 trafficking and immune regulation , the following experimental design strategies are recommended:

Cell-Based Trafficking Assays:

  • Pulse-Chase Analysis:

    • Express fluorescently tagged TLR4 in cells with normal or modified CNIH4 levels

    • Track TLR4 movement from ER to plasma membrane using confocal microscopy

    • Quantify trafficking kinetics and surface expression levels

    • Compare results between wild-type and CNIH4 knockout/knockdown cells

  • Flow Cytometry Assessment:

    • Measure surface TLR4 levels using PE-coupled anti-TLR4 antibodies

    • Compare TLR4 surface expression in control vs. CNIH4-modulated cells

    • Analyze data using standardized gating strategies

    • Correlate CNIH4 expression levels with TLR4 surface abundance

Molecular Interaction Studies:

  • Co-Immunoprecipitation:

    • Transfect cells with tagged CNIH4 and TLR4

    • Perform reciprocal immunoprecipitations

    • Analyze precipitates by Western blotting

    • Map interaction domains using deletion mutants

  • TMED7-CNIH4-TLR4 Interaction Analysis:

    • Generate recombinant proteins of all three components

    • Perform pull-down assays to determine direct interactions

    • Use proximity ligation assays to visualize interactions in situ

    • Investigate whether CNIH4 competes with or facilitates TMED7-TLR4 binding

Functional Immune Response Assays:

  • NF-κB Activation Measurement:

    • Use THP1-Lucia NF-κB reporter cells with CNIH4 manipulation

    • Treat with LPS (0.1 μg/ml) for 24h after CNIH4 knockdown/overexpression

    • Measure luciferase activity as a readout of TLR4 signaling

    • Normalize data to cell viability and expression levels

  • Cytokine Production Assessment:

    • Collect supernatants from wild-type and CNIH4-modified cells after LPS stimulation

    • Measure TNFα and IL-6 levels by ELISA at 6h, 12h, and 24h post-stimulation

    • Compare cytokine production kinetics and magnitudes

    • Correlate with surface TLR4 levels

In Vivo Models:

  • LPS Challenge in Mouse Models:

    • Compare wild-type and CNIH4 knockout mice responses to LPS

    • Administer 35 μg LPS per g of mouse weight intraperitoneally

    • Collect blood samples at defined time points (e.g., 150 min post-injection)

    • Analyze plasma cytokine levels and immune cell activation markers

    • Assess tissue-specific responses, particularly in immune-relevant organs

Data Interpretation Framework:

  • Establish clear baseline measurements for all experiments

  • Use appropriate statistical tests (typically ANOVA with post-hoc tests for multiple comparisons)

  • Create integrated models that connect molecular interactions to cellular phenotypes and organismal responses

  • Consider alternative explanations for observed phenomena

What emerging technologies could advance our understanding of CNIH4 function in protein trafficking pathways?

Several cutting-edge technologies offer promising approaches to elucidate CNIH4 function:

Advanced Imaging Technologies:

  • Cryo-Electron Tomography:

    • Visualize CNIH4-containing vesicles in near-native states

    • Resolve 3D structures of COPII coat assemblies with CNIH4

    • Map cargo distribution within individual vesicles

  • Super-Resolution Microscopy:

    • Track individual CNIH4 molecules with 20-30nm precision using PALM/STORM

    • Visualize CNIH4-cargo interactions in live cells with lattice light-sheet microscopy

    • Implement expansion microscopy to resolve spatial relationships at ER exit sites

Genetic Engineering Approaches:

  • CRISPR-based Screening:

    • Perform genome-wide CRISPR screens for modifiers of CNIH4 function

    • Use CRISPRa/CRISPRi for precise modulation of CNIH4 expression

    • Generate knock-in reporters to track endogenous CNIH4 in real-time

  • Optogenetic Control:

    • Develop light-inducible CNIH4 dimerization systems to control cargo binding

    • Create optogenetically regulated CNIH4 expression models

    • Implement spatiotemporal control of CNIH4 activity within specific cellular compartments

Proteomics and Structural Biology Integration:

  • Proximity Labeling Proteomics:

    • Use APEX2 or BioID fusions with CNIH4 to identify proximal proteins

    • Map the dynamic interactome of CNIH4 during vesicle formation

    • Compare interactomes across different cell types and conditions

  • AlphaFold/RoseTTAFold Integration:

    • Generate accurate structural predictions of CNIH4-cargo complexes

    • Model CNIH4 interactions with COPII components

    • Design structure-based mutations to test functional hypotheses

Single-Cell Technologies:

  • Single-Cell Proteomics:

    • Profile CNIH4-dependent secretomes at single-cell resolution

    • Correlate CNIH4 expression with cellular phenotypes

    • Identify cell-specific CNIH4 functions in heterogeneous populations

  • Spatial Transcriptomics/Proteomics:

    • Map CNIH4 expression patterns in tissue contexts

    • Correlate with cargo distribution and cell type markers

    • Understand tissue-specific regulation of CNIH4 expression

How might recombinant CNIH4 be utilized in developing therapeutic strategies targeting secretory pathway defects?

Recombinant CNIH4 has potential therapeutic applications in addressing secretory pathway disorders:

Therapeutic Target Identification:

  • Structure-Based Drug Design:

    • Use purified recombinant CNIH4 for crystallization and structure determination

    • Identify druggable pockets for small molecule development

    • Design inhibitors or activators of specific CNIH4-cargo interactions

  • High-Throughput Screening:

    • Develop FRET-based assays with recombinant CNIH4 and cargo proteins

    • Screen compound libraries for modulators of CNIH4 function

    • Validate hits in cellular models of secretory pathway disorders

Precision Medicine Applications:

  • Biomarker Development:

    • Use recombinant CNIH4 as standards for quantitative assays

    • Develop diagnostic tests for CNIH4-related pathway dysfunctions

    • Correlate CNIH4 levels or mutations with disease progression

  • Patient Stratification:

    • Screen patient samples for CNIH4 expression and mutation status

    • Correlate with response to therapies targeting secretory pathways

    • Identify CNIH4-dependent cancer subtypes for targeted therapy

Protein Replacement Strategies:

  • Cell-Penetrating CNIH4 Variants:

    • Engineer recombinant CNIH4 with cell-penetrating peptides

    • Develop liposomal delivery systems for transmembrane protein delivery

    • Test functional rescue in cellular models of CNIH4 deficiency

  • Gene Therapy Approaches:

    • Design viral vectors for CNIH4 delivery to specific tissues

    • Regulate expression using tissue-specific promoters

    • Implement inducible expression systems for controlled correction

Immunomodulatory Applications:

  • TLR4 Pathway Modulation:

    • Develop CNIH4-based inhibitors of TLR4 trafficking

    • Target excessive inflammatory responses in sepsis or autoimmune conditions

    • Create screening platforms to identify compounds that modulate CNIH4-dependent TLR4 transport

  • Cancer Immunotherapy Enhancements:

    • Target CNIH4 to modify immune checkpoint expression on cancer cells

    • Combine with existing checkpoint inhibitors for improved efficacy

    • Develop CNIH4-targeted strategies for immunostimulatory cargo delivery to tumors

Table: Potential Therapeutic Applications of CNIH4 Research

Disease CategoryCNIH4-Related MechanismTherapeutic ApproachDevelopment Stage
Inflammatory DisordersTLR4 transport regulationCNIH4 inhibitors to reduce TLR4 surface expressionPreclinical
CancerCell cycle promotion, immune checkpoint regulationCNIH4 knockdown, selective inhibition of cancer-specific cargoTarget validation
Secretory DisordersDefective protein transportRecombinant CNIH4 delivery, gene therapyConceptual
Neurodegenerative DiseasesAberrant receptor traffickingModulation of CNIH4-dependent AMPA receptor transportEarly research

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.