Recombinant Bovine Protein FAM162A (FAM162A)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
FAM162A; E2IG5; Protein FAM162A; E2-induced gene 5 protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MGSLRGLRLVAGSCFRSCERDAFSSLRLTRNSDLKRTNGFCSKPQESPKPPDQHTYSHRV PLHKPTDWEKKILIWSGRFKKEDEIPETVSFEMLDAAKNKVRVKISYVMIALTVAGCVLM VIEGKKAARRNETLTSLNLEKKARLREEAAMKAKTE
Uniprot No.

Target Background

Function

Proposed roles include apoptosis regulation; the precise mechanism varies across cell types and tissues. It may be involved in hypoxia-induced cell death in transformed cells, potentially through cytochrome C release, caspase activation (e.g., CASP9), and mitochondrial permeability transition. In neuronal cells, it may contribute to hypoxia-induced cell death by facilitating AIFM1 release from mitochondria into the cytoplasm and subsequent nuclear translocation. However, the involvement of caspases in this process remains a subject of ongoing investigation and conflicting reports exist.

Database Links

KEGG: bta:617104

STRING: 9913.ENSBTAP00000014796

UniGene: Bt.9210

Protein Families
UPF0389 family
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is FAM162A and what is its evolutionary significance in research models?

    FAM162A (Family with sequence similarity 162 member A) is a mitochondrial protein first identified in 2004 as a target of the transcription factor HIF-1α. It exhibits remarkable evolutionary conservation across taxa, with protein homology ranging from 99% in primates to approximately 50% in fish when compared to the human version . This high conservation suggests fundamental biological importance, making bovine FAM162A a valuable model for comparative studies. While initially characterized for its role in hypoxia-induced apoptosis through VDAC binding and mPTP opening, recent research reveals it plays critical roles in mitochondrial structure maintenance and bioenergetics, creating an interesting research paradigm involving seemingly contradictory functions .

  • Where is FAM162A localized within mitochondria and how does this impact experimental design?

    FAM162A primarily localizes to the inner mitochondrial membrane (IMM), particularly within the cristae membrane (CM) . Protease protection assays reveal that FAM162A possesses two transmembrane segments with both N- and C-termini facing the mitochondrial matrix, while the connecting loop resides within the cristae lumen . This specific localization has significant implications for experimental design:

    Experimental ConsiderationMethodological Approach
    Protein extractionRequires specialized mitochondrial membrane solubilization techniques
    ImmunolocalizationInner membrane markers (vs. outer membrane) required as controls
    Functional assaysMust account for cristae-specific functions and interactions
    Expression systemsNeed proper mitochondrial targeting sequences for correct localization

    When designing experiments with recombinant bovine FAM162A, researchers must ensure proper targeting to the IMM through preservation of mitochondrial targeting sequences and appropriate expression systems.

  • How does FAM162A affect mitochondrial function and what are the key experimental readouts?

    Loss-of-function experiments demonstrate that FAM162A is critical for mitochondrial function and cell viability. When FAM162A is knocked down in cell models:

    • Cell viability decreases by approximately 30%

    • Cell mortality increases by about 30%

    • Mitochondrial membrane potential is reduced by 50%

    Key experimental readouts for assessing FAM162A's impact on mitochondrial function include:

    Functional ParameterMeasurement Technique
    Membrane potentialFluorescent dyes (JC-1, TMRM)
    Oxygen consumptionSeahorse extracellular flux analysis
    OXPHOS protein levelsImmunoblotting of respiratory complexes
    ATP productionLuminescence-based assays
    Mitochondrial morphologyConfocal microscopy with mitochondrial stains

    These parameters provide comprehensive assessment of how FAM162A impacts mitochondrial bioenergetics in experimental systems.

  • What is the structure of FAM162A protein and how does this inform functional studies?

    3D protein structure modeling through AlphaFold 2.0 reveals that FAM162A contains two transmembrane segments, an extended loop with a short alpha-helix domain, and a C-terminus alpha-helix structure . This structural arrangement corresponds with its localization in the IMM, where both N- and C-termini face the mitochondrial matrix.

    For functional studies, this structure suggests:

    • The transmembrane domains are likely critical for proper insertion into the IMM

    • The loop region may mediate interactions with other proteins in the intermembrane space

    • The C-terminal helix might be involved in matrix-facing interactions

    When designing recombinant constructs or mutation studies, researchers should consider how modifications might disrupt this native structure and consequently affect function.

  • How does FAM162A expression vary across tissues and how might this affect research focus?

    At the organism level, FAM162A mRNA displays higher expression in colon, esophagus, heart, kidney, and liver . This tissue-specific expression pattern suggests differential requirements for FAM162A function across cell types, which should inform experimental design:

    Tissue TypeRelative ExpressionResearch Implications
    ColonHighMay have specific roles in intestinal epithelial metabolism
    HeartHighPotential importance in high-energy demanding cardiac tissue
    KidneyHighPossible roles in renal physiological processes
    LiverHighMay impact metabolic functions in hepatocytes
    Other tissuesModerate to lowConsider tissue-specific functions when designing models

    When working with recombinant bovine FAM162A, researchers should consider these tissue-specific expression patterns when selecting cell types for heterologous expression or when designing in vivo studies.

Advanced Research Questions

  • How can researchers effectively investigate the paradoxical dual role of FAM162A in both apoptosis and cell survival?

    FAM162A presents a fascinating paradox: it was initially characterized as pro-apoptotic under hypoxic conditions, yet it's overexpressed in cancer where it correlates with increased proliferation and migration rather than cell death . This contradiction requires sophisticated experimental approaches:

    Research ApproachMethodologyExpected Insight
    Context-dependent studiesCompare FAM162A function under normoxia vs. hypoxiaDetermine oxygen-dependent functional switching mechanisms
    Interactome analysisIP-MS under different conditionsIdentify condition-specific binding partners
    Domain mappingTruncation/mutation constructsDetermine which regions mediate apoptotic vs. survival functions
    Post-translational modification profilingMS-based PTM analysisIdentify modifications that might switch function
    Temporal dynamicsTime-course experimentsDetermine if function changes with duration of expression

    The key is designing experiments that can isolate variables (oxygen level, cell type, stress conditions) to determine what factors govern the switch between pro-apoptotic and pro-survival functions.

  • What are the optimal approaches for studying FAM162A's interaction with OPA1 and impacts on mitochondrial dynamics?

    FAM162A modulates the mitochondrial fusion protein OPA1, suggesting a role in regulating mitochondrial dynamics . To investigate this interaction and its functional consequences:

    Experimental ApproachMethodologyTechnical Considerations
    Direct interaction studiesCo-IP, proximity ligation assay, FRETRequires antibodies with minimal cross-reactivity
    Mitochondrial morphologySuper-resolution microscopyQuantitative analysis of fusion/fission events
    OPA1 processingImmunoblotting for OPA1 isoformsDetection of both long and short OPA1 forms
    Cristae remodelingElectron microscopyQuantification of cristae width, number, and organization
    Functional consequencesMeasurement of membrane potential, ROS, ATPCorrelation between morphological and functional changes

    A comprehensive approach would combine protein interaction assays with morphological and functional readouts to establish mechanistic links between FAM162A-OPA1 interaction and mitochondrial dynamics.

  • What are the optimal expression systems and purification strategies for recombinant bovine FAM162A?

    Expression and purification of functional mitochondrial membrane proteins presents significant challenges:

    Expression SystemAdvantagesLimitationsRecommendations
    E. coliHigh yield, low costLimited PTMs, inclusion body formationUse specialized strains (C41/C43); fusion tags to enhance solubility
    Insect cellsBetter folding, some PTMsModerate cost, lower yieldBaculovirus expression with 6xHis tag for purification
    Mammalian cellsNative folding, complete PTMsHighest cost, lowest yieldHEK293 or CHO cells with inducible expression

    Purification strategy:

    1. Isolate mitochondria using differential centrifugation

    2. Solubilize membranes with mild detergents (DDM, LMNG)

    3. Affinity chromatography (IMAC for His-tagged protein)

    4. Size exclusion chromatography for final purification

    5. Verify protein integrity through circular dichroism and functional assays

    Critical considerations include maintaining the native conformation of transmembrane domains and preserving potential post-translational modifications.

  • How can researchers establish transgenic models to study FAM162A function in vivo?

    Transgenic approaches have proven valuable for studying FAM162A, as demonstrated by Drosophila models overexpressing human FAM162A that showed extended lifespan and enhanced stress resistance :

    Model OrganismAdvantagesTechnical ApproachExpected Outcomes
    DrosophilaRapid generation, lifespan studiesGAL4-UAS system for tissue-specific expressionLifespan, stress resistance, metabolic changes
    ZebrafishVertebrate model, embryo transparencyTol2 transposon systemDevelopmental effects, tissue-specific function
    MouseMammalian physiologyCRISPR/Cas9 for knockin/knockoutTissue-specific effects, metabolic parameters

    For bovine FAM162A studies specifically, researchers might:

    1. Generate species-matched models (bovine cells)

    2. Create cross-species complementation models to test functional conservation

    3. Develop conditional expression systems to control timing of expression

    4. Include reporter genes to track expression patterns in vivo

    Phenotypic analysis should focus on mitochondrial function, stress resistance, and lifespan/healthspan metrics.

  • What methodologies are most effective for investigating the role of FAM162A under cellular stress conditions?

    Given FAM162A's involvement in stress response pathways:

    Stress ConditionExperimental ApproachKey ReadoutsControls
    HypoxiaControlled O₂ chambers (1-5%)HIF-1α levels, FAM162A expressionTime-matched normoxia
    Oxidative stressH₂O₂, paraquat treatmentROS levels, cell viabilityAntioxidant co-treatment
    Metabolic stressGlucose deprivation, 2-DGATP levels, AMPK activationNutrient rescue
    Heat stressTemperature elevation (39-42°C)HSP induction, protein aggregationTemperature-matched wild-type
    ER stressTunicamycin, thapsigarginUPR markers, mitochondria-ER contactsChemical chaperone co-treatment

    For comprehensive analysis:

    1. Establish dose-response and time-course relationships

    2. Compare wild-type vs. FAM162A-deficient cells/organisms

    3. Assess both acute and chronic stress responses

    4. Measure stress recovery after stimulus removal

    5. Combine with mitochondrial function assays to link stress response to bioenergetics

  • How can researchers quantitatively assess FAM162A's impact on mitochondrial cristae organization?

    FAM162A's localization to cristae membranes suggests a role in maintaining cristae organization :

    Assessment MethodTechnical ApproachQuantitative ParametersAnalytical Considerations
    Transmission electron microscopyUltrathin sections of fixed samplesCristae width, number, surface areaStatistical analysis of multiple sections
    Electron tomography3D reconstruction of serial sectionsCristae junction diameter, cristae connectivityComplex image processing requirements
    Super-resolution microscopySTED/PALM imaging of mitochondrial markersSpatial organization of inner membrane proteinsResolution limitations (~20-30nm)
    Biochemical fractionationDensity gradient separation of submitochondrial particlesProtein distribution between IBM and cristaePotential for fractionation artifacts
    Functional correlatesATP synthesis rate, respiratory complex assemblyIndirect measures of cristae integrityLink structure to function

    Quantitative analysis should include:

    1. Automated image analysis with appropriate controls

    2. Comparison between FAM162A-deficient and wild-type samples

    3. Correlation between structural changes and functional parameters

    4. Assessment under both basal and stressed conditions

  • What approaches can determine the molecular mechanisms by which FAM162A influences mitochondrial bioenergetics?

    To establish mechanistic links between FAM162A and bioenergetic function:

    Mechanistic AspectExperimental ApproachExpected Insights
    Respiratory chain complex assemblyBlue native PAGE, complex activity assaysDirect effects on ETC organization
    Supercomplex formationDigitonin-solubilized BN-PAGEImpact on respiratory efficiency
    Cristae organizationElectron microscopy, tomographyStructure-function relationships
    Lipid compositionLipidomic analysis of mitochondrial fractionsEffects on membrane properties
    Protein-protein interactionsIP-MS, crosslinking studiesDirect binding partners
    Metabolic substrate utilizationSeahorse analysis with different substratesPathway-specific effects
    Bioenergetic ParameterFAM162A-Deficient CellsControl CellsFold Change
    Basal respirationTypically decreasedNormal~0.5-0.7x
    Maximal respirationSignificantly decreasedNormal~0.3-0.5x
    ATP productionDecreasedNormal~0.6-0.8x
    Membrane potentialReducedNormal~0.5x
    Proton leakVariableNormalContext-dependent

    These approaches can establish whether FAM162A directly affects respiratory complex function or indirectly influences bioenergetics through cristae organization.

  • How can researchers investigate potential post-translational modifications of FAM162A?

    Western blot assays have shown two distinct bands for FAM162A, suggesting potential post-translational modifications :

    Modification TypeDetection MethodFunctional Assessment
    PhosphorylationPhospho-specific antibodies, Phos-tag gelsPhosphatase treatment, phosphomimetic mutations
    UbiquitinationAnti-ubiquitin immunoblotting, UbiScanProteasome inhibitors, ubiquitin-binding domain pulldowns
    AcetylationAnti-acetyl-lysine antibodiesHDAC/SIRT inhibitors, acetylation-mimetic mutations
    Proteolytic processingN/C-terminal tagged constructsSite-directed mutagenesis of potential cleavage sites
    Oxidative modificationsRedox proteomics, diagonal electrophoresisReducing/oxidizing conditions, Cys→Ala mutations

    Comprehensive PTM mapping requires:

    1. Enrichment of FAM162A from mitochondrial fractions

    2. Mass spectrometry analysis (MS/MS, ETD fragmentation)

    3. Site-directed mutagenesis of identified modification sites

    4. Functional assays to determine the impact of modifications

    5. Assessment under different cellular conditions (normoxia/hypoxia, stress/basal)

  • What bioinformatic approaches can help identify novel interaction partners and functional domains of FAM162A?

    Computational approaches can guide experimental investigations:

    Bioinformatic MethodApplicationExpected Outcomes
    Sequence motif analysisIdentify functional domains, targeting sequencesPotential protein-protein interaction motifs
    Structural homology modelingBeyond AlphaFold predictionFunctional prediction based on structural similarity
    Protein-protein interaction predictionSTRING, PrePPI databasesCandidate interacting partners
    Evolutionary rate analysisKa/Ks ratios across speciesIdentification of conserved functional regions
    Transcriptional co-expressionRNA-seq meta-analysisCo-regulated genes suggesting functional relationships
    PTM site predictionPhosphoSitePlus, UbiSitePotential regulatory sites

    Integration of these approaches can generate testable hypotheses about:

    1. Critical functional domains within bovine FAM162A

    2. Species-specific differences in function or regulation

    3. Potential regulatory mechanisms

    4. Novel protein-protein interactions

    5. Involvement in specific cellular pathways

  • How can researchers differentiate between direct and indirect effects of FAM162A on mitochondrial function?

    Establishing causality in complex mitochondrial networks requires:

    Experimental ApproachMethodologyCausal Insights
    Acute vs. chronic manipulationInducible expression/knockdown systemsTemporal relationship between FAM162A levels and phenotypes
    Rescue experimentsRe-expression of wild-type or mutant formsDomain-specific functional complementation
    Direct binding assaysIn vitro reconstitution with purified componentsPhysical interactions without cellular context
    Proximity labelingBioID or APEX2 fusionsSpatial relationship in native environment
    Epistasis analysisDouble knockdowns/overexpressionPathway position relative to other factors
    In vitro systemsPurified mitochondria or submitochondrial particlesDirect functional effects without cellular compensation

    A systematic approach combining these methods can help distinguish:

    1. Primary effects (direct consequences of FAM162A function)

    2. Secondary effects (downstream of primary effects)

    3. Compensatory responses (cellular adaptations to FAM162A manipulation)

    4. Context-dependent effects (different outcomes under varying conditions)

    This differentiation is critical for establishing the precise mechanistic role of FAM162A in mitochondrial biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.