Recombinant Bovine Protein FAM168B (FAM168B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
FAM168B; Myelin-associated neurite-outgrowth inhibitor; Mani
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
FAM168B
Target Protein Sequence
MNPVYSPGSSGVPYANAKGIGYPGYTSGTPYKVSCSPTSGAVPPYSSSPNPYQTAVYPVR SAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTTVVQPNGMPATVYPAPLPPPRGNGVTMGM VAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTYRAPGTPTYSYVPPQW
Uniprot No.

Target Background

Function
Inhibitor of neuronal axonal outgrowth. Functions as a negative regulator of CDC42 and STAT3 and a positive regulator of STMN2. Also acts as a positive regulator of CDC27.
Database Links

KEGG: bta:505853

UniGene: Bt.55355

Protein Families
FAM168 family
Subcellular Location
Cytoplasm, perinuclear region. Cell membrane; Multi-pass membrane protein. Cell projection, axon.

Q&A

What is the FAM168B protein and its function?

FAM168B (also known as MANI, Myelin-associated neurite-outgrowth inhibitor) is one of two members of the family with sequence similarity 168 (FAM168) genes. Phylogenetic analyses reveal that the earliest emergence of these genes occurred in jawed vertebrates like Callorhinchus milii . FAM168B functions primarily as a neurite-outgrowth inhibitor associated with myelin, suggesting its critical role in neuronal growth regulation and potentially in limiting neuronal regeneration after injury. In humans, FAM168B consists of 195 amino acids with a calculated molecular weight of approximately 20 kDa .

What are the key evolutionary characteristics of FAM168B genes?

FAM168B demonstrates distinct evolutionary patterns that provide insight into its biological significance:

  • FAM168B orthologs are present in vertebrates ranging from Callorhinchus milii to Homo sapiens, displaying distinct taxonomic clusters across fish, amphibians, reptiles, birds, and mammals .

  • FAM168B genes show notable differences from their paralog FAM168A. Most significantly, FAM168A in livebearing mammals contains a distinctive intermediate exon 4 (comprising 27 nucleotides) that is absent in FAM168B and in the FAM168A genes of egg-laying mammals .

  • Both FAM168A and FAM168B are absent in non-vertebrate chordates like branchiostoma and tunicates that possess a notochord at some developmental stage .

This evolutionary profile suggests FAM168B emerged alongside the development of more complex nervous systems in vertebrates.

How should recombinant bovine FAM168B be stored and reconstituted?

Proper storage and reconstitution are critical for maintaining the stability and functionality of recombinant FAM168B:

ParameterRecommended Conditions
Storage Temperature-20°C/-80°C upon receipt; aliquoting is necessary for multiple use
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution MethodBriefly centrifuge vial before opening; reconstitute in deionized sterile water to 0.1-1.0 mg/mL
Long-term StorageAdd 5-50% glycerol (final concentration) and aliquot for storage at -20°C/-80°C
Working StorageStore working aliquots at 4°C for up to one week
Stability ConsiderationsAvoid repeated freeze-thaw cycles

Following these guidelines will help preserve the structural integrity and biological activity of recombinant bovine FAM168B throughout your research applications.

What expression systems are most effective for recombinant bovine FAM168B?

The choice of expression system significantly impacts the yield, folding, and functionality of recombinant bovine FAM168B:

  • E. coli expression systems: BL21(DE3) strains are commonly used for recombinant protein expression . Similar to approaches used for recombinant bovine SRY protein, vectors like pET32a(+) can be employed for expression in E. coli cells . This system is advantageous for high-yield production but may lack certain post-translational modifications.

  • Yeast expression systems: For proteins requiring more complex folding, Pichia pastoris can be an effective alternative. This system has demonstrated success with other recombinant bovine proteins, yielding up to 3.5 g/L of recombinant protein .

  • Mammalian expression systems: When mammalian-specific post-translational modifications are crucial for function, HEK293 cells provide a suitable expression platform .

The optimal expression system should be selected based on specific research requirements, considering factors such as protein folding complexity, post-translational modification needs, yield requirements, and downstream applications.

How does codon optimization improve recombinant bovine FAM168B expression?

Codon optimization can substantially enhance the expression efficiency of recombinant bovine proteins in heterologous hosts like E. coli:

  • Codon Adaptation Index (CAI): For recombinant bovine SRY protein, codon optimization increased the CAI from 51% to 85% with E. coli, dramatically improving expression levels .

  • Rare codon identification and replacement: Wild-type bovine genes typically contain several codons that are rare in E. coli:

    • Arginine codons: AGG, AGA, CGA

    • Proline codons: CCC

    • Leucine codons: CTA

    • Isoleucine codons: ATA

    Substituting these with more common E. coli codons significantly enhances expression efficiency .

  • Improved protein solubility: Research with recombinant bovine SRY demonstrated that the codon-optimized sequence (cobSRY) produced more soluble protein than the wild-type sequence (wtbSRY) under identical expression conditions .

  • Altered optimal expression temperature: Interestingly, codon optimization can shift the optimal expression temperature. For wild-type bovine SRY, 27°C was optimal, while for codon-optimized SRY, 32°C yielded the highest soluble protein .

For recombinant bovine FAM168B, implementing similar codon optimization strategies would likely enhance both expression levels and protein solubility in bacterial expression systems.

What are the optimal induction conditions for maximizing soluble FAM168B yield?

Based on studies with other recombinant bovine proteins, the following induction parameters can be optimized to maximize soluble FAM168B yield:

  • IPTG concentration: For recombinant bovine SRY protein, 0.3 mM IPTG provided the highest soluble protein yield. Higher concentrations (0.6-1.2 mM) increased total protein production but resulted predominantly in inclusion bodies .

  • Induction temperature: Temperature significantly affects protein solubility. Lower temperatures generally slow protein synthesis, allowing more time for proper folding:

    • For wild-type bovine sequences: 27°C typically yields more soluble protein

    • For codon-optimized sequences: 32°C may be optimal

    • Higher temperatures (37°C): Result in more rapid expression but higher inclusion body formation

  • Growth media composition: The addition of stabilizers can significantly impact solubility:

    • Arginine (0.2 M) enhances solubility of recombinant bovine proteins

    • Sorbitol (0.3 M) improves solubility

    • Low glucose concentrations (5 mM) improve solubility compared to higher concentrations (20 mM) which increase inclusion body formation

  • Cell density at induction: Optimal induction occurs when cultures reach an OD600 of 0.6-0.8 .

  • Induction duration: Typically, 4-5 hours of induction with shaking at approximately 130 rpm provides optimal results .

The precise optimal conditions should be determined empirically for FAM168B using systematic experimental design approaches.

Which Design of Experiments (DOE) approach is most effective for optimizing FAM168B production?

Optimizing recombinant FAM168B production involves multiple interacting variables, making systematic statistical design approaches essential:

  • Comparative analysis of DOE methods:

    DOE MethodAdvantagesLimitationsSuitability for FAM168B
    Rotatable Central Composite Design (RCCD)Estimates quadratic effects and interactionsHigher variability in model fittingModerate
    Box-Behnken Design (BBD)Fewer experimental runs than RCCDLimited for edge conditionsGood
    Face-Centered Central Composite Design (FCCD)More robust for biological systemsRequires multiple center pointsVery good
    Mixture Design (MD)Optimal for relative proportionsLimited for absolute quantity effectsVery good
    MD coupled with FCCDCombines strengths of both approachesMore complex analysisExcellent
  • Evidence-based recommendation: Research with recombinant protein production has demonstrated that MD coupled with FCCD outperformed all other approaches, improving volumetric productivity 109-fold . This combined approach is therefore highly recommended for FAM168B optimization.

  • Implementation considerations:

    • Blocking is essential to reduce variability caused by uncontrolled random effects

    • The R-square value indicates model fit quality (values >0.95 are desirable)

    • Statistically significant p-values (<0.01) for factors indicate real effects

  • Key parameters to optimize:

    • IPTG concentration

    • Temperature

    • Stabilizer concentrations (arginine, sorbitol)

    • Media composition

    • pH and induction time

This systematic approach enables efficient identification of optimal production conditions while minimizing experimental runs.

How can statistical analysis help identify significant factors affecting FAM168B solubility?

Statistical analysis plays a crucial role in identifying which variables significantly impact FAM168B solubility:

  • ANOVA and significance testing: Analysis of variance can determine which factors significantly affect protein solubility. For recombinant bovine proteins:

    • IPTG concentration showed significant effects (p < 0.001)

    • Temperature demonstrated significant effects (p < 0.001)

    • Arginine and sorbitol concentrations significantly affected solubility (p < 0.01)

    • Glucose and glycerol concentrations showed no significant effects

  • Interaction effects analysis: Statistical models can reveal how factors interact:

    • In coupled two-factor FCCD analysis of recombinant proteins, the interactions between transfection reagent and total DNA amount were significant (p < 0.01)

    • These interactions would be missed in single-factor optimization approaches

  • Variability assessment: Different statistical models show varying abilities to account for experimental variability:

    • MD-two-factor FCCD typically exhibits the highest R-square values (0.97)

    • BBD shows good performance (R-square = 0.95)

    • FCCD and RCCD show slightly lower performance (R-square = 0.89 and 0.87, respectively)

  • Response surface methodology: This approach maps how different combinations of factors affect solubility, helping visualize optimal conditions and the sensitivity of the system to parameter changes .

Understanding which factors significantly impact FAM168B solubility allows researchers to focus optimization efforts on the most influential parameters, saving time and resources while maximizing protein quality.

How do different chemical additives affect the solubility of recombinant bovine FAM168B?

Chemical additives can significantly enhance the solubility of recombinant proteins by stabilizing their native conformation and preventing aggregation:

  • Amino acids and derivatives:

    • Arginine (0.2 M): Significantly enhances solubility of recombinant bovine proteins, likely by suppressing protein-protein interactions through interaction with exposed hydrophobic patches

    • Mechanism: Arginine interacts with both the protein surface and the solvent, creating a favorable environment for proper folding

  • Polyols and sugars:

    • Sorbitol (0.3 M): Demonstrated significant improvement in recombinant bovine protein solubility

    • Trehalose (6%): Commonly used in storage buffers to maintain protein stability through its water replacement mechanism

    • Mechanism: These compounds stabilize proteins through preferential hydration and by altering water structure around the protein

  • Detergents and surfactants (at concentrations below CMC):

    • Can prevent hydrophobic interactions that lead to aggregation

    • Must be carefully selected to avoid protein denaturation

  • pH and buffer considerations:

    • Tris/PBS-based buffers at pH 8.0 are commonly used for recombinant proteins

    • The optimal pH should be determined experimentally for FAM168B

  • Concentration-dependent effects:

    • Glucose: Low concentrations (5 mM) improve solubility while high concentrations (20 mM) increase inclusion body formation

    • Glycerol: Low concentrations (5 mM) relatively improve solubility compared to higher concentrations

The optimal combination of additives should be determined through systematic experimentation, as additive effects can be protein-specific and may interact with other expression conditions.

What protein engineering approaches can improve FAM168B solubility?

Protein engineering offers powerful strategies to enhance the solubility of recombinant FAM168B:

  • Fusion partners:

    • Thioredoxin (Trx): Enhances solubility through its intrinsic chaperone-like activity

    • SUMO (Small Ubiquitin-like Modifier): Promotes proper folding and can be removed by specific proteases

    • MBP (Maltose Binding Protein): Large solubility enhancer that can also serve as a purification tag

    • Selection should consider downstream applications and whether tag removal is necessary

  • Surface charge modification:

    • Strategic substitution of surface residues can enhance solubility

    • Increasing net charge (either positive or negative) often reduces aggregation

    • Neutralizing hydrophobic patches through introduction of polar residues

  • Codon optimization strategies:

    • Beyond simple substitution of rare codons, codon optimization can be designed to:

      • Moderate translation rates at complex structural domains

      • Ensure proper co-translational folding

      • Research with bovine proteins shows codon optimization improved solubility significantly

  • Truncation and domain-based approaches:

    • Expression of functional domains rather than full-length protein

    • Removal of hydrophobic regions not essential for function

    • Identification of minimal functional units through bioinformatic analysis

  • Disulfide engineering:

    • Introduction or removal of disulfide bonds to stabilize tertiary structure

    • Requires careful structural analysis or modeling

Each approach should be evaluated experimentally, with optimal strategies potentially combining multiple approaches for maximum solubility enhancement.

How can multi-omics approaches reveal FAM168B's role in neuronal pathways?

Multi-omics integration offers powerful strategies for understanding FAM168B's function in complex neuronal pathways:

  • Integration methodologies:

    • DIABLO method: Successfully used to integrate proteomics and transcriptomics data, identifying key biomarkers and molecular pathways

    • Data preprocessing requirements: Raw data must be transformed, normalized, and filtered to ensure compatibility across platforms

  • Comprehensive omics layers for FAM168B research:

    • Transcriptomics: RNA-Seq to identify genes co-expressed with FAM168B or affected by its manipulation

    • Proteomics: Mass spectrometry to identify protein-protein interactions and post-translational modifications

    • Epigenomics: Analysis of DNA methylation patterns affecting FAM168B expression or regulation

    • Metabolomics: Identification of metabolic pathways affected by FAM168B activity

  • Statistical considerations for multi-omics integration:

    • High-dimensional data requires sophisticated statistical approaches

    • Sample heterogeneity must be addressed through proper experimental design

    • Correlation analyses between different data types can reveal functional relationships

  • Functional network analysis:

    • Pathway enrichment analyses to place FAM168B in biological context

    • Identification of functional clusters through network analysis

    • Prediction of FAM168B's role in neuronal development and inhibition pathways

  • Validation strategies:

    • Targeted gene knockdown or overexpression to confirm predicted interactions

    • Protein-protein interaction validation through co-immunoprecipitation

    • Functional assays to test predicted pathway effects

This multi-layered approach can reveal previously unknown functions of FAM168B beyond its characterized role in neurite growth inhibition, potentially identifying novel therapeutic targets for neurological conditions.

What role does arginine methylation play in FAM168B function?

Post-translational arginine methylation represents a critical regulatory mechanism affecting FAM168B function:

  • Methylation patterns in FAM168B:

    • Human FAM168B contains symmetrically methylated arginine in the peptide sequence QTAVYPVR(me2s)SAYPQQ

    • This modification creates recognition sites for effector proteins containing Tudor domains

  • Tudor domain interactions:

    • Tudor domains form aromatic-binding cages that interact with methyl marks through cation-π interactions

    • Multiple Tudor domain-containing proteins (approximately 30 in humans) can potentially "read" the methylarginine marks on FAM168B

    • These interactions may recruit FAM168B to specific cellular compartments or protein complexes

  • SART3 as a methylarginine reader:

    • SART3 has been identified as an effector that recognizes methylarginine motifs through its HAT domain

    • The interaction depends on a cluster of five aromatic residues (Y112, F142, W149, Y180, and W377) that are conserved in vertebrates

  • Functional implications:

    • Arginine methylation may regulate FAM168B's inhibitory activity in neurons

    • The modification could affect protein-protein interactions crucial for signaling

    • Temporal and spatial regulation of methylation may provide a mechanism for fine-tuning inhibitory effects

  • Methodological considerations:

    • Recombinant FAM168B produced in E. coli lacks these methylation marks

    • For studies where methylation is important, either mammalian expression systems should be used or in vitro methylation can be performed post-purification

Understanding these methylation-dependent interactions provides insight into the molecular mechanisms regulating FAM168B's neurobiological functions and offers potential targets for therapeutic intervention.

How can Bayesian optimization accelerate FAM168B expression optimization?

Bayesian Optimization (BO) represents a sophisticated approach to optimizing the complex biological process of recombinant FAM168B expression:

  • Advantages over traditional optimization approaches:

    • Efficiency: Requires significantly fewer experimental runs than full factorial designs

    • Adaptability: Updates the probabilistic model after each iteration based on previous results

    • Mathematical foundation: Balances exploration of new conditions with exploitation of promising regions

  • Implementation for FAM168B expression optimization:

    • Sequential optimization strategy: First optimize media composition, then specific additives and expression conditions

    • Media blend optimization: Test different ratios of commercial media to maximize cell viability

    • Parameter space: Include IPTG concentration (0-1.2 mM), temperature (27-37°C), and stabilizer concentrations (arginine 0-0.4 M, sorbitol 0-0.6 M)

  • Response surface visualization: The approach generates a probabilistic model of how multiple variables interact to affect FAM168B yield, revealing:

    • Regions of parameter space with highest predicted yield

    • Uncertainty in different regions

    • Unexpected interactions between variables

  • Case study results: Application of similar approaches to recombinant protein production has demonstrated yield improvements of up to 109-fold compared to standard conditions .

This systematic approach dramatically accelerates optimization while providing deeper insights into the factors governing successful FAM168B expression.

How should researchers compare wild-type and recombinant bovine FAM168B for functional studies?

When comparing wild-type and recombinant bovine FAM168B for functional studies, researchers must account for several critical differences:

  • Structural considerations:

    • Affinity tags: Recombinant FAM168B typically contains N-terminal or C-terminal tags (e.g., His-tag) that may affect protein structure and function

    • Post-translational modifications: Recombinant FAM168B produced in E. coli lacks mammalian post-translational modifications, particularly arginine methylation that creates binding sites for Tudor domain proteins

    • Folding differences: Expression conditions affect protein folding, potentially resulting in structural differences from native protein

  • Experimental validation approaches:

    • Activity assays: Compare neurite outgrowth inhibition potency between native and recombinant protein

    • Binding studies: Compare interaction profiles with known binding partners

    • Thermal stability analysis: Differential scanning fluorimetry to compare structural stability

    • Limited proteolysis: Assess conformational differences through digestion patterns

  • Strategies to minimize differences:

    • Tag removal: Use proteolytic cleavage to remove affinity tags post-purification

    • Expression system selection: Consider mammalian expression systems for studies where post-translational modifications are critical

    • Buffer optimization: Identify buffer conditions that stabilize native-like conformations

  • Quantitative comparison methodology:

    • Dose-response curves: Generate complete dose-response relationships rather than single-point comparisons

    • Statistical analysis: Apply appropriate statistical tests (e.g., two-way ANOVA) to determine significant differences

    • Multiple functional parameters: Assess multiple aspects of function rather than a single metric

What are the most robust neurite outgrowth inhibition assays for studying FAM168B function?

Neurite outgrowth inhibition assays are critical for characterizing FAM168B's biological function as a myelin-associated inhibitor:

  • Substrate-bound inhibition assays:

    • Droplet assay methodology:

      • Immobilize purified recombinant FAM168B (300 ng) as a 3 μL droplet on nitrocellulose-coated plates

      • Coat the surrounding area with permissive substrate (laminin)

      • Plate embryonic day 13 (E13) dorsal root ganglion (DRG) neurons

      • After 24-48 hours, fix and stain for neuronal markers

      • Quantify inhibition by measuring neurite length and crossing events at the boundary

    • Control conditions:

      • Positive control: PBS droplets should show no inhibition of neurite outgrowth

      • Comparative control: Other known inhibitors like human OMG for reference

  • Soluble inhibitor assays:

    • Growth cone collapse assay:

      • Culture neurons on permissive substrate

      • Add soluble recombinant FAM168B at various concentrations

      • Visualize growth cone morphology using phase-contrast or fluorescence microscopy

      • Quantify percentage of collapsed growth cones

    • Time-lapse analysis:

      • Record growth cone dynamics before and after FAM168B addition

      • Measure retraction velocity, filopodial dynamics, and recovery times

  • 3D culture systems:

    • Neurons embedded in 3D matrices more closely resemble in vivo environments

    • FAM168B can be incorporated into the matrix or added as a gradient

    • Confocal microscopy enables visualization of neurite behavior in three dimensions

  • Quantification parameters:

    • Neurite length (total and longest)

    • Branching complexity (number of branch points)

    • Growth cone area and morphology

    • Neurite density

    • Boundary crossing events

  • Statistical analysis:

    • Use multiple biological replicates (n≥3)

    • Apply appropriate statistical tests to determine significance of inhibitory effects

    • Consider variability in neuronal responses by analyzing sufficient numbers of neurons per condition

These robust assays provide comprehensive characterization of FAM168B's inhibitory function while controlling for experimental variables that might affect interpretation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.