Recombinant Bovine Protein FAM19A5 (FAM19A5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we can prioritize the development of a specified tag if provided in advance.
Synonyms
TAFA5; FAM19A5; Chemokine-like protein TAFA-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
FAM19A5
Target Protein Sequence
MAPSPRTGSRQDATALPSMSSTFWAFMILASLLIAYCSQLAAGTCEIVTLDRDSSQPRRT IARQTARCACRKGQIAGTTRARPACVDARIIRTKQWCDMLPCLEGEGCDLLINRSGWTCT QPGGRIKTTTVS
Uniprot No.

Target Background

Function
Recombinant Bovine FAM19A5 functions as a chemokine-like protein, regulating cell proliferation and migration via G protein-coupled receptors (GPCRs), including S1PR2 and FPR2. It stimulates macrophage chemotaxis through the MAPK3/ERK1 and AKT1 pathways. Furthermore, it inhibits TNFSF11/RANKL-induced osteoclast formation by suppressing the upregulation of osteoclast fusion and differentiation genes. This macrophage migration stimulation and osteoclast formation inhibition are mediated by the GPCR FPR2. FAM19A5 also acts as an adipokine, negatively regulating vascular smooth muscle cell (VSMC) proliferation and migration in response to platelet-derived growth factor stimulation. This regulation occurs through GPCR S1PR2 and G protein GNA12/GNA13-mediated RHOA signaling. Ultimately, it inhibits injury-induced cell proliferation and neointima formation in femoral arteries.
Database Links
Protein Families
FAM19/TAFA family
Subcellular Location
Secreted.

Q&A

What is FAM19A5 and how is it structurally characterized?

FAM19A5 belongs to the family with sequence similarity 19 (FAM19) or TAFA family of secretory proteins with cytokine-like properties. Human FAM19A5 is 132 amino acids in length, containing a signal peptide comprising the first 43 N-terminal amino acids. The mature protein sequence (Gln26-Ser125) represents the active form used in most recombinant preparations. FAM19A5 is predicted to be distantly related to the CC-chemokine family, though it demonstrates unique structural and functional properties . The bovine FAM19A5 (Uniprot: Q3ZBS2) shares high sequence homology with human FAM19A5, making it a valuable model for comparative studies.

What are the expression patterns of FAM19A5 in normal physiology?

FAM19A5 shows a characteristic tissue distribution pattern with predominant expression in the central nervous system (CNS), particularly in the basal ganglia and cerebellum . Interestingly, recent studies have also demonstrated significant expression in adipose tissue, though this expression is downregulated in obese mice . Unlike other members of the TAFA family which show more restricted expression, FAM19A5 exhibits a broader distribution pattern while maintaining its highest expression in neural tissues. This suggests potential multi-system roles for this protein beyond the CNS.

How evolutionarily conserved is FAM19A5 across species?

FAM19A5 demonstrates remarkable evolutionary conservation, with human TAFA5 showing 100% amino acid identity to mouse TAFA5 . Additionally, the binding domain sequences involved in protein-protein interactions are highly conserved across vertebrate species, suggesting critical functional importance. Within the TAFA family, FAM19A5 stands as the most distinct member, while TAFAs 2, 3, and 4 show closer evolutionary relationships . This high degree of conservation indicates essential biological functions preserved throughout vertebrate evolution.

Which receptors are known to interact with FAM19A5?

FAM19A5 has been identified to interact with multiple receptors, with formyl peptide receptor 2 (FPR2) being a critical mediator of its effects on osteoclastogenesis. The inhibitory effect of FAM19A5 on osteoclast formation is significantly reversed by FPR2 antagonists or in FPR2-deficient models, confirming this receptor's importance . Additionally, sphingosine-1-phosphate receptor 2 (S1PR2) has been identified as a functional receptor for FAM19A5 in vascular smooth muscle cells, with a dissociation constant (Kd) of 0.634 nmol/L . Recent research has also revealed that FAM19A5 interacts with the FB domain of leucine-rich repeat containing protein 4B (LRRC4B) with remarkably high affinity (KD of 32 pM) .

What downstream signaling pathways are activated by FAM19A5?

Upon binding to FPR2, FAM19A5 activates signaling cascades that ultimately inhibit RANKL-induced osteoclastogenesis through downregulation of osteoclast-related genes such as RANK, TRAF6, OSCAR, TRAP, Blimp1, c-fos, and NFATc1, while upregulating negative regulators of osteoclastogenesis including MafB and IRF-8 . When signaling through S1PR2, FAM19A5 activates the G12/13-RhoA pathway, which inhibits vascular smooth muscle cell proliferation and migration . In neuronal contexts, FAM19A5 binding to LRRC4B disrupts the interaction between LRRC4B and PTPRF (a presynaptic adhesion molecule), potentially leading to synapse elimination .

How does FAM19A5 regulate gene expression in target cells?

FAM19A5 demonstrates sophisticated regulation of gene expression profiles in various cellular contexts. In osteoclast precursors, it significantly downregulates fusogenic genes essential for osteoclast formation, including OC-STAMP, DC-STAMP, and Atp6v0d2 . Conversely, it upregulates inhibitory transcription factors that suppress osteoclastogenesis. The protein has also been shown to modulate expression of synaptic proteins in neuronal cultures, with treatment of primary hippocampal neurons with FAM19A5 leading to decreased expression of both pre- and post-synaptic markers, synaptophysin (SYP) and postsynaptic density protein 95 (PSD95) .

What expression systems are optimal for producing recombinant FAM19A5?

Recombinant FAM19A5 has been successfully produced in Escherichia coli expression systems, as documented in multiple studies . When expressing FAM19A5, it is crucial to express the mature protein sequence (typically Gln26-Ser125 for human FAM19A5) without the signal peptide to ensure proper folding and biological activity. For the bovine protein (UniProt: Q3ZBS2), similar considerations apply. Expression can be optimized using appropriate tags, though these should be removable if they might interfere with functional assays. Carrier-free preparations are recommended for applications where the presence of carrier proteins might interfere with experimental outcomes .

What are the recommended storage and handling conditions for recombinant FAM19A5?

Recombinant FAM19A5 is typically stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage, while extended storage is recommended at -20°C or -80°C . Repeated freezing and thawing should be avoided to maintain protein integrity and activity. Working aliquots can be stored at 4°C for up to one week . For experimental use, the protein concentration range of 0.1-2 μM has been demonstrated effective for biological assays such as osteoclast formation inhibition studies .

What functional assays are most appropriate for evaluating FAM19A5 activity?

Several validated functional assays can assess FAM19A5 activity:

Assay TypeMethodologyTypical ReadoutApplication
Chemotactic MigrationTranswell migration assay with bone marrow-derived macrophagesMigration indexAssessment of chemokine-like activity
Osteoclastogenesis InhibitionRANKL-induced osteoclast differentiation from BMDMs with TRAP stainingOsteoclast number and sizeEvaluation of bone metabolism effects
Receptor BindingSurface plasmon resonance (SPR) or radioligand bindingKd/Ka valuesCharacterization of receptor interactions
Neurite OutgrowthPrimary neuronal cultures with FAM19A5 immobilizationNeurite length and branchingAssessment of neuronal effects
Vascular Cell ProliferationBrdU incorporation assay with vascular smooth muscle cellsProliferation rateEvaluation of cardiovascular effects

How can FAM19A5 be utilized in neurological disorder research?

FAM19A5 has emerged as a promising target in neurological disorder research, particularly in Alzheimer's Disease (AD). Recent findings indicate that FAM19A5 contributes to synapse loss through its interaction with LRRC4B and subsequent disruption of the LRRC4B-PTPRF complex . FAM19A5 levels in human cerebrospinal fluid increase with aging and tau accumulation, suggesting its role as an accelerator of synaptic elimination. Researchers have developed antibody-based approaches (e.g., NS101) targeting FAM19A5 to prevent excessive synapse loss in AD models, with promising results showing restoration of mature synapse numbers and cognitive behaviors . This approach represents a novel therapeutic avenue for neurodegenerative disorders characterized by synapse loss.

What is the role of FAM19A5 in cardiovascular research and potential therapeutics?

FAM19A5 has been identified as a novel adipokine that inhibits neointima formation after vascular injury. Studies have shown that overexpression of FAM19A5 markedly inhibits vascular smooth muscle cell proliferation and migration in balloon-injured rat carotid arteries . Adipose-specific FAM19A5 transgenic mice demonstrate significant attenuation of neointima formation compared to wild-type littermates, even when fed Western-style diets. The mechanism involves FAM19A5 binding to sphingosine-1-phosphate receptor 2, activating the G12/13-RhoA pathway . These findings suggest that FAM19A5 could be a promising therapeutic target for preventing restenosis after angioplasty and other obesity-related cardiovascular diseases.

How does FAM19A5 interact with other protein complexes in regulatory networks?

FAM19A5 participates in sophisticated protein interaction networks that regulate critical physiological processes. Recent studies have revealed its high-affinity interaction (KD of 32 pM) with the FB domain of LRRC4B, specifically within amino acids 484-498 . This interaction disrupts the LRRC4B-PTPRF complex, potentially leading to synapse elimination. Molecular modeling and mutational analyses have identified key residues involved in this interaction: Arg125 and Lys127 of FAM19A5 are particularly critical for LRRC4B binding . Understanding these interaction networks provides opportunities for developing targeted interventions for conditions characterized by dysregulated FAM19A5 signaling.

What are common challenges in FAM19A5 functional studies and how can they be addressed?

Researchers working with FAM19A5 often encounter several challenges:

  • Protein stability: FAM19A5 may show reduced stability in certain buffer conditions. Using carrier proteins (like BSA) can enhance stability, though carrier-free versions are recommended for applications where BSA might interfere .

  • Receptor specificity: Since FAM19A5 interacts with multiple receptors (FPR2, S1PR2, LRRC4B), determining which receptor mediates observed effects requires careful experimental design. Use receptor antagonists (e.g., WRW4 for FPR2) or receptor-deficient models to clarify specific receptor contributions .

  • Physiological relevance: In vitro concentrations should be carefully selected to match estimated physiological ranges. FAM19A5 shows activity at 0.1-2 μM in osteoclast formation assays, providing a starting point for dosage considerations .

How should researchers interpret contradictory findings regarding FAM19A5 functions?

Contradictory findings regarding FAM19A5 may stem from several factors:

  • Context-dependent effects: FAM19A5 functions may vary dramatically between tissues and cell types. For example, its expression is downregulated in obesity in adipose tissue, suggesting different regulatory mechanisms across systems .

  • Isoform variations: Multiple isoforms of FAM19A5 exist, including membrane-bound and secreted forms. Ensure that experiments clearly specify which isoform is being studied .

  • Species differences: While highly conserved, subtle species differences exist. When comparing across studies, note whether human, mouse, bovine, or other species' proteins were used .

  • Methodological variations: Differences in recombinant protein preparation, concentrations, and assay conditions can lead to apparently contradictory results. Standardizing methods and reporting detailed protocols can help resolve these discrepancies.

What are emerging areas of FAM19A5 research that require further investigation?

Several promising research directions for FAM19A5 warrant further investigation:

  • Role in metabolic disorders: Given its expression in adipose tissue and downregulation in obesity, further studies should explore FAM19A5's potential role in metabolic regulation and insulin sensitivity .

  • Therapeutic applications in neurodegeneration: Building on findings that FAM19A5 contributes to synapse elimination, developing targeted interventions that modulate its activity could provide novel treatments for diseases characterized by synapse loss .

  • Bone homeostasis regulation: Further investigation of FAM19A5's inhibitory effects on osteoclastogenesis could yield insights for osteoporosis and other bone disorders .

  • Cardiovascular protection mechanisms: More detailed understanding of FAM19A5's protective effects against neointima formation could inform new approaches to preventing restenosis after vascular interventions .

  • Interactome mapping: Comprehensive characterization of FAM19A5's interaction partners across different tissues will provide deeper insights into its diverse physiological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.