Recombinant Bovine Protein FAM210A (FAM210A)

Shipped with Ice Packs
In Stock

Description

2.1. Mitochondrial Translation Regulation

FAM210A plays a crucial role in regulating mitochondrial translation, which is essential for maintaining mitochondrial homeostasis and normal cellular function . Mitochondria are vital for cellular metabolism and energy production, and their dysfunction can lead to various diseases, especially those affecting the heart .

  • Mechanism of Action FAM210A modulates the translation of mitochondrial-encoded mRNAs, ensuring the proper production of proteins necessary for mitochondrial function . Loss of FAM210A function impairs mitochondrial mRNA translation, leading to reduced levels of mitochondrial-encoded proteins and disrupted proteostasis .

2.2. Cardiac Function

Research indicates that FAM210A is essential for maintaining cardiac health . Studies using conditional knockout mouse models have shown that the absence of FAM210A in cardiomyocytes leads to severe mitochondrial disruption and functional decline, ultimately resulting in dilated cardiomyopathy and heart failure .

  • Impact of FAM210A Deficiency Deficiency in FAM210A results in increased production of mitochondrial reactive oxygen species, disturbed mitochondrial membrane potential, and reduced respiratory activity in cardiomyocytes . These issues precede contractile dysfunction and heart failure, indicating that FAM210A is critical in the early stages of maintaining cardiac health .

  • Benefits of FAM210A Overexpression Overexpression of FAM210A has been shown to promote the expression of mitochondrial-encoded proteins, improve cardiac mitochondrial function, and protect the heart from damage caused by ischemia . This suggests that enhancing FAM210A levels could be a potential therapeutic strategy for treating ischemic heart disease .

2.3. Muscle Health

FAM210A is also associated with muscle mass and function . Studies have shown that FAM210A expression is positively correlated with muscle mass, and its deficiency can lead to myopathy and muscle weakness .

  • Role in Myofibers Loss of FAM210A disrupts the structure of mitochondrial cristae and reduces the abundance of mitochondria in myofibers, leading to deficiencies in mitochondrial energy metabolism . This ultimately results in systemic metabolic defects and premature death in mouse models .

3.1. Genetic Association Studies

Genome-wide association studies (GWAS) have identified associations between the FAM210A gene and bone and muscle traits . Specifically, genetic variations near FAM210A are linked to appendicular and whole-body lean mass .

  • rs1941749: This single nucleotide polymorphism (SNP) is significantly associated with bone mineral density (BMD) estimated from the heel calcaneus .

  • rs4796995: This SNP is significantly associated with fracture risk .

  • rs9955264 and rs1284201: These SNPs are associated with appendicular lean mass and whole-body lean mass, respectively .

3.2. Cardiac Remodeling and Heart Failure

FAM210A expression is reduced in human ischemic heart failure and mouse myocardial infarction tissue samples . This reduction is associated with adverse cardiac remodeling and damage .

  • Multi-omics Analysis Multi-omics analyses reveal that FAM210A deficiency activates an integrated stress response, leading to transcriptomic, translatomic, proteomic, and metabolomic reprogramming, which contributes to the progression of heart failure .

3.3. Mitochondrial Homeostasis

FAM210A is crucial for maintaining mitochondrial homeostasis in cardiomyocytes by regulating the translation of mitochondria-encoded mRNAs .

  • Mitochondrial Morphology and Function In the absence of FAM210A, mitochondria exhibit severe morphological disruption and functional decline . This includes reduced mitochondrial membrane potential and increased production of reactive oxygen species .

4.1. Genetic Associations with Bone and Muscle Traits

SNPTraitP-value
rs1941749eBMD (heel calcaneus)3.5 × 10-43
rs4796995Fracture8.8 × 10-13
rs9955264Appendicular lean mass5.2 × 10-3
rs1284201Whole body lean mass1.4 × 10-2

4.2. Impact of FAM210A Deficiency on Cardiac Function

ParameterObservation
Mitochondrial MorphologySevere disruption
Mitochondrial Membrane PotentialReduced
Reactive Oxygen Species (ROS)Increased
Respiratory ActivityReduced
Cardiac FunctionProgressive dilated cardiomyopathy and heart failure

Potential Therapeutic Applications

Given its role in maintaining mitochondrial function and protecting against cardiac damage, FAM210A represents a promising therapeutic target for treating ischemic heart disease and other conditions related to mitochondrial dysfunction . Gene therapy approaches involving AAV9-mediated overexpression of FAM210A have shown promise in rescuing murine hearts from cardiac remodeling and damage in ischemia-induced heart failure .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAM210A; Protein FAM210A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
FAM210A
Target Protein Sequence
MQWNVPKTVFRLAHRTCMEPHKAGLLGHCQNMKGPLLLYTLESRVVVVQGPQKRWLHLPT AQCVAKERKPFTAVQSQPGVFHHKQWEQDILSKRVLSSSATSSGPPSEKKEDPDPLQDRS ISLYQRFKKTFRQYGKVLIPVHLITSAVWFGTFYYAAMKGVNVVPFLELIGLPDSIVNIL KNSQSGNALTAYALFKIATPARYTVTLGGTSFTVKYLRSRGYMSTPPPVKEYLQDKMEET KELLTEKMEETKDRLTEKLQETKGKVSLKKKVE
Uniprot No.

Target Background

Function

May play a role in the structural integrity and strength of both muscle and bone tissue.

Database Links
Protein Families
FAM210 family
Subcellular Location
Membrane; Single-pass membrane protein. Mitochondrion. Cytoplasm.

Q&A

What is the structural composition of FAM210A protein?

FAM210A contains a mitochondrial targeting signal (MTS) at its N-terminus, followed by a transmembrane domain, a DUF1279 (Domain of Unknown Function) domain, and a coiled-coil domain at its C-terminus . This structural arrangement suggests its localization to the mitochondrial membrane and potential involvement in protein-protein interactions. When designing experiments with recombinant FAM210A, researchers should consider these domains for functional studies, particularly if creating truncated versions for domain-specific analyses.

Where is FAM210A primarily expressed in mammalian tissues?

FAM210A is highly expressed in tissues rich in mitochondria, including the heart, kidney, brown adipose tissue (BAT), and various skeletal muscles such as the diaphragm, tibialis anterior (TA), and soleus . This expression pattern correlates with its mitochondrial function. Researchers should consider tissue-specific expression levels when designing experiments, especially for comparative studies across different tissue types.

What are the primary cellular functions of FAM210A?

FAM210A functions as a mitochondrial inner membrane protein that plays crucial roles in:

  • Mitochondrial cristae remodeling and thermogenesis, particularly in brown adipose tissue

  • Regulation of mitochondrial mRNA translation and maintenance of mitochondrial homeostasis

  • Mediating inter-organelle crosstalk between mitochondria and ribosomes

  • Supporting muscle and bone structure and strength

Research designs should account for these multiple functions when investigating FAM210A in specific physiological processes.

What expression systems are optimal for recombinant FAM210A production?

For human FAM210A protein expression, wheat germ cell-free systems have been successfully employed to produce functional protein in the 1-272 amino acid range . For bovine FAM210A, similar cell-free systems may be appropriate, though bacterial systems might require optimization due to the transmembrane domains. Consider testing multiple expression systems in parallel, including insect cells which often provide better folding for mitochondrial proteins.

How should researchers validate mitochondrial localization of FAM210A in cell culture models?

A systematic approach should include:

  • Mitochondrial fractionation followed by Western blotting

  • Immunofluorescence microscopy with mitochondrial markers (e.g., MitoTracker)

  • Functional rescue experiments in FAM210A-depleted cells

  • Co-localization experiments with known inner mitochondrial membrane proteins

Control experiments should include N-terminal MTS deletion constructs to confirm targeting sequence functionality.

What functional assays are recommended for assessing FAM210A activity in vitro?

Based on FAM210A's known functions, recommended assays include:

  • Mitochondrial translation efficiency assays using radiolabeled amino acids

  • OPA1 cleavage assays to assess cristae remodeling function

  • Mitochondrial respiratory capacity measurements via Seahorse analyzer

  • Protein interaction studies with translation machinery components

  • Thermal shift assays to evaluate protein stability under various conditions

These assays should be calibrated with positive and negative controls to ensure reliable interpretation of results.

How does FAM210A regulate mitochondrial cristae remodeling in brown adipose tissue?

FAM210A governs OPA1 cleavage by modulating YME1L/OMA1 protease activity, facilitating mitochondrial cristae dynamics under cold challenge . Researchers investigating this pathway should employ both in vitro biochemical assays and in vivo models. The experimental approach should include:

  • Analysis of OPA1 processing in the presence and absence of FAM210A

  • Co-immunoprecipitation studies with YME1L and OMA1

  • Electron microscopy to visualize cristae morphology changes

  • Cold exposure experiments in tissue-specific knockout models

Research contradictions might arise from different cold exposure protocols or mouse genetic backgrounds, which should be carefully controlled.

What is the role of FAM210A in cardiac mitochondrial function and heart failure pathogenesis?

FAM210A loss of function in cardiomyocytes leads to progressive dilated cardiomyopathy and heart failure through impaired mitochondrial translation . Reduced FAM210A expression has been observed in both human ischemic heart failure and mouse myocardial infarction models . When investigating cardiac functions:

  • Monitor mitochondrial respiration, ROS production, and membrane potential

  • Perform mitochondrial polysome profiling to assess translation efficiency

  • Analyze integrated stress response (ISR) activation through key markers

  • Consider AAV9-mediated overexpression to evaluate potential therapeutic effects in heart failure models

Data from these assays should be integrated to distinguish primary from secondary effects of FAM210A deficiency.

What molecular mechanisms underlie FAM210A's role in muscle mass regulation?

FAM210A expression positively correlates with muscle mass in both mice and humans . Researchers should investigate:

  • Protein synthesis rates in muscle cells with varied FAM210A expression

  • Mitochondrial-cytosolic signaling pathways affected by FAM210A levels

  • Interaction partners in ribosomal complexes during muscle hypertrophy

  • Effects on muscle stem cell activation and differentiation

Differentiate between acute and chronic adaptations to FAM210A modulation when designing these experiments.

How can FAM210A be targeted for therapeutic benefit in ischemic heart disease?

AAV9-mediated overexpression of FAM210A promotes mitochondrial-encoded protein expression, improves cardiac mitochondrial function, and partially rescues murine hearts from cardiac remodeling and damage in ischemia-induced heart failure . Therapeutic research should:

  • Optimize viral delivery vectors for cardiac-specific targeting

  • Determine minimum effective dose through dose-response studies

  • Evaluate long-term effects and potential off-target consequences

  • Consider pharmacological approaches to stabilize or increase FAM210A activity

Efficacy measurements should include both functional (echocardiography) and molecular (mitochondrial function) parameters.

What is the relationship between FAM210A mutations and sarcopenia?

Human FAM210A mutations have been associated with sarcopenia . Researchers investigating this relationship should:

  • Characterize specific mutations in terms of protein stability and function

  • Create cellular and animal models with corresponding mutations

  • Assess age-dependent progression of muscle phenotypes

  • Analyze muscle biopsy samples from sarcopenia patients for FAM210A expression and mitochondrial function

Both loss-of-function and gain-of-function mutations should be considered in experimental designs.

How does FAM210A contribute to thermogenic adaptation in cold exposure?

As a cold-inducible mitochondrial protein essential for thermogenesis , FAM210A research in this context should include:

  • Time-course analysis of FAM210A induction during cold exposure

  • Comparison between acute and chronic cold adaptation

  • Measurement of UCP1-dependent and UCP1-independent thermogenesis

  • Metabolic flux analysis to trace substrate utilization patterns

Control for confounding factors such as diet, housing conditions, and age when interpreting thermogenesis data.

What are the optimal storage and handling conditions for recombinant FAM210A protein?

For maintaining stability and activity of recombinant FAM210A:

  • Store purified protein at -80°C in small aliquots to avoid freeze-thaw cycles

  • Include 10-15% glycerol in storage buffer to prevent denaturation

  • Validate protein functionality after each purification using activity assays

  • Consider including reducing agents if the protein contains cysteine residues

Protein stability should be monitored via thermal shift assays or activity measurements over time.

How can researchers differentiate between the direct and indirect effects of FAM210A in multi-omics studies?

Multi-omics analyses indicate that FAM210A deficiency persistently activates integrated stress response (ISR), leading to transcriptomic, translatomic, proteomic, and metabolomic reprogramming . To differentiate direct from indirect effects:

  • Perform acute induction/depletion experiments with time-course sampling

  • Use proximity labeling approaches to identify direct interaction partners

  • Employ rescue experiments with specific downstream effectors

  • Create a hierarchical model of changes based on temporal appearance

Triangulation of results from different omics platforms can help establish causality versus correlation.

What controls are essential when studying mitochondrial translation regulated by FAM210A?

Since FAM210A regulates mitochondrial mRNA translation , critical controls include:

  • Comparison with known mitochondrial translation factors (positive controls)

  • Assessment of cytosolic translation to confirm specificity

  • Rescue experiments with wild-type versus mutant FAM210A

  • Evaluation of mitochondrial mRNA levels to rule out transcriptional effects

Standardize experimental conditions including cell confluence and metabolic state to reduce variability in translation assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.