Recombinant Bovine Protein FAM73B (FAM73B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MIGA2; FAM73B; Mitoguardin 2; Protein FAM73B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-593
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MIGA2
Target Protein Sequence
MAFRRTEGMSMIQALAMTVAEIPVFLYTTFGQSAFSQLRLTPGLRKVLFATALGTVALAL AAHQLKRRRRKKKQVGPEMGGEHLGTVPLPILMARKVPSVKKGYSNRRVQSPSSKSNDTL SGISSIEPSKHSGSSHSLASMVVVNSSSPTAACSGPWETRGIEESVTTADGNAESLYMQG MELFEEALQKWEQALSVGQRGDSGSTPTPGDGLRNPETASEALSEPESQRKEFAEKLESL LHRAYHLQEEFGSTFPADSMLLDLERTLMLPLTEGSLRLRADDGDSLTSEDSFFSATELF ESLQVGDYPIPLSRPAAAYEEALQLVKEGKVPCRTLRTELLGCYSDQDFLAKLHCVRQAF EGLLEDKSHQLFFGEVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELE GRGVVCMSFFDIVLDFILMDAFEDLENPPSSVLAVLRNRWLSDSFKETALATACWSVLKA KRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLSEVCAFFKHQIVQYLTDMFDLDN VRYTSVPALAEDILQLSRRRSEILLGYLGVPAASSIGLNGVLPRENGPPEALQ
Uniprot No.

Target Background

Function

Function: Recombinant Bovine Protein FAM73B acts as a regulator of mitochondrial fusion. It achieves this by forming homo- and heterodimers on the mitochondrial outer membrane, facilitating the creation of PLD6/MitoPLD dimers. Its mechanism of action may involve modulating phospholipid metabolism through PLD6/MitoPLD interaction.

Database Links
Protein Families
Mitoguardin family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

What is the function of FAM73B in bovine cellular systems?

FAM73B is a mitochondrial outer membrane protein involved in mitochondrial dynamics and function. It plays a critical role in mitochondrial membrane organization and may participate in the formation of membrane contact sites (MCSs) between mitochondria and other organelles. Research suggests that FAM73B contains motifs that potentially enable interactions with VAP proteins at the endoplasmic reticulum, facilitating inter-organelle communication. Studying this protein requires techniques that preserve native mitochondrial structure, such as gentle cell lysis methods followed by subcellular fractionation and western blotting with anti-FAM73B antibodies .

How should recombinant bovine FAM73B be stored to maintain optimal activity?

Recombinant FAM73B protein should be stored following general guidelines for recombinant proteins to maintain functionality. Most recombinant proteins can withstand up to four freeze-thaw cycles without significant loss of activity . For optimal preservation, aliquot the purified protein into single-use volumes to minimize freeze-thaw cycles. Store at -80°C for long-term storage, or at 4°C for up to 1-2 weeks if in regular use. Activity testing between storage conditions (e.g., comparing 4°C storage versus freeze-thawed samples) should be performed to validate stability, similar to the protocols used for other recombinant proteins where activity is measured before and after storage .

What expression systems are most effective for producing functional recombinant bovine FAM73B?

For membrane proteins like FAM73B, mammalian expression systems typically yield the most functionally relevant recombinant protein. HEK293 or CHO cells are preferred for expressing bovine FAM73B as they provide appropriate post-translational modifications and folding machinery. Bacterial systems like E. coli may be used for producing fragments that don't require complex folding or modifications. For full-length FAM73B, consider using vectors with strong CMV promoters and appropriate secretion signals if studying the secreted form, or without secretion signals if studying the membrane-bound form. Codon optimization for the expression host and inclusion of purification tags (His, FLAG, etc.) that don't interfere with protein function are recommended methodological approaches to improve yield and purity .

What endotoxin levels are acceptable for FAM73B when used in cellular assays?

For cellular assays using recombinant FAM73B, endotoxin levels should be less than 0.1 ng per μg protein or 1 EU per μg protein, which is the standard threshold for recombinant proteins used in biological systems . High endotoxin levels can activate cellular pathways that confound experimental results, particularly in immune cell assays. Testing for endotoxin contamination should be performed using the Limulus Amebocyte Lysate (LAL) assay, which is the gold standard for endotoxin detection. For particularly sensitive applications such as primary cell cultures or in vivo studies, using preparations with even lower endotoxin levels (< 0.01 EU/μg) may be advisable to prevent non-specific cellular activation .

How can I determine if recombinant bovine FAM73B is properly folded and functional?

Assessing the proper folding and functionality of recombinant bovine FAM73B requires multiple complementary approaches:

  • Structural integrity assessment: Use circular dichroism (CD) spectroscopy to analyze secondary structure elements and compare with predicted structural models.

  • Thermal shift assays: Measure protein stability and proper folding using differential scanning fluorimetry.

  • Functional assays: Since FAM73B is involved in mitochondrial membrane dynamics, assess its ability to integrate into artificial lipid bilayers or mitochondrial membranes.

  • Binding partner verification: Test interaction with known binding partners using pull-down assays with recombinant MSP domains of VAP proteins, which interact with potential FFAT motifs in FAM73B .

  • Subcellular localization: Express tagged FAM73B in bovine cells and verify proper mitochondrial outer membrane localization using confocal microscopy.

A properly folded and functional FAM73B should demonstrate the expected secondary structure, thermal stability profile, membrane integration capability, and specific protein-protein interactions.

What are the recommended protocols for phosphorylation analysis of potential FFAT motifs in FAM73B?

For analyzing potential phosphorylation-dependent FFAT motifs in FAM73B, employ the following methodological approaches:

  • Motif identification: Use position weight matrix algorithms to identify potential Phospho-FFAT motifs within the FAM73B sequence, focusing on serine or threonine residues at position 4 of potential FFAT sequences .

  • Mass spectrometry analysis: Express and purify FAM73B from cells, then perform trypsin and chymotrypsin digestion followed by LC/MS/MS analysis to identify phosphorylated residues, similar to methods used for other proteins with Phospho-FFAT motifs .

  • Phospho-specific antibodies: Generate antibodies against predicted phosphorylation sites to monitor phosphorylation status by western blotting.

  • Peptide binding assays: Synthesize biotinylated peptides corresponding to potential FFAT motifs in FAM73B with and without phosphorylation at key serine/threonine residues. Test binding to recombinant MSP domains of VAP-A and VAP-B using pull-down assays followed by SDS-PAGE analysis .

  • Mutation analysis: Create phospho-mimetic (S/T to D/E) and phospho-deficient (S/T to A) mutants to assess the functional importance of phosphorylation at these sites.

This comprehensive approach allows for precise identification and functional characterization of phosphorylation-dependent interactions.

How can I optimize coimmunoprecipitation experiments to identify FAM73B interaction partners?

Optimizing coimmunoprecipitation (co-IP) experiments for FAM73B requires special considerations due to its membrane localization:

  • Gentle lysis conditions: Use buffers containing 1% digitonin or 0.5-1% NP-40/Triton X-100 to solubilize membrane proteins while preserving protein-protein interactions.

  • Crosslinking approach: Consider using membrane-permeable crosslinkers like DSP (dithiobis(succinimidyl propionate)) prior to cell lysis to stabilize transient interactions.

  • Antibody selection: Use highly specific antibodies against FAM73B or employ recombinant FAM73B with epitope tags (FLAG, HA, etc.) placed at positions that don't interfere with protein function.

  • Pre-clearing strategy: Pre-clear lysates with protein A/G beads to reduce non-specific binding.

  • Validation controls: Include negative controls (IgG, non-transfected cells) and positive controls (known interactors if available).

  • Elution method: For mass spectrometry analysis, use on-bead digestion rather than elution to improve sensitivity.

  • Reciprocal co-IP: Confirm interactions by performing reverse co-IP with antibodies against potential interacting partners.

This optimized protocol enhances specificity and sensitivity in identifying genuine FAM73B interaction partners while minimizing false positives often encountered with membrane proteins.

How can I establish a cell-based assay to measure FAM73B's role in mitochondrial fusion/fission dynamics?

To establish a cell-based assay for studying FAM73B's role in mitochondrial dynamics:

  • Cell system selection: Use bovine cells with endogenous FAM73B expression or create stable cell lines with inducible FAM73B expression systems.

  • Mitochondrial visualization: Stably express mitochondrial markers like mito-DsRed or mito-GFP to enable live cell imaging of mitochondrial morphology.

  • FAM73B manipulation:

    • Knockdown using siRNA or CRISPR-Cas9

    • Overexpression of wild-type or mutant variants

    • Creation of phospho-mimetic and phospho-deficient mutants of potential FFAT motifs

  • Dynamic imaging: Perform time-lapse confocal microscopy to track changes in mitochondrial morphology over time (15-30 minutes with 10-30 second intervals).

  • Quantitative analysis:

    • Measure mitochondrial length, branching, and connectivity

    • Calculate fusion/fission events per unit time

    • Use automated image analysis software (e.g., Mitograph, MiNA)

  • Functional correlation: Correlate morphological changes with functional readouts such as:

    • Mitochondrial membrane potential (TMRM staining)

    • ATP production

    • Oxygen consumption rate (Seahorse analyzer)

This comprehensive assay system allows for detailed quantitative assessment of FAM73B's specific contribution to mitochondrial dynamics, beyond simple morphological observations.

What are the methodological approaches to study potential phosphorylation-dependent interactions between FAM73B and VAP proteins?

To study phosphorylation-dependent interactions between FAM73B and VAP proteins:

  • Computational prediction:

    • Screen FAM73B sequence for potential Phospho-FFAT motifs using specialized algorithms

    • Score potential motifs based on similarity to consensus sequences

  • In vitro binding studies:

    • Express and purify recombinant MSP domains of VAP-A and VAP-B

    • Synthesize biotinylated peptides corresponding to potential FFAT motifs in FAM73B with various phosphorylation states

    • Conduct pull-down assays using peptide-conjugated streptavidin beads

    • Analyze binding by SDS-PAGE and Western blotting

  • Cellular validation:

    • Create phospho-mimetic (S/T→D/E) and phospho-deficient (S/T→A) FAM73B mutants at predicted sites

    • Express in cells and perform co-IP with VAP proteins

    • Analyze interaction dynamics using FRET or BiFC (Bimolecular Fluorescence Complementation)

  • Kinase identification:

    • Use kinase prediction tools to identify potential kinases for the phosphorylation sites

    • Perform in vitro kinase assays with recombinant kinases and FAM73B fragments

    • Use kinase inhibitors or kinase knockdown to validate in cells

  • Functional consequences:

    • Examine how phosphorylation affects mitochondria-ER contact sites using electron microscopy or split-GFP contact site reporters

    • Assess impacts on lipid transfer, calcium signaling, or other contact site functions

This methodological approach enables detailed characterization of phosphorylation-dependent interaction mechanisms similar to those established for other proteins with Phospho-FFAT motifs .

How can I assess the impact of FAM73B on mitochondrial-ER contact sites formation?

To assess FAM73B's role in mitochondrial-ER contact site formation:

  • Proximity-based reporters:

    • Implement split fluorescent protein systems (split-GFP, GRASP) with one component targeted to mitochondria via FAM73B and the other to ER

    • Use FRET-based sensors with acceptor/donor fluorophores on opposite organelles

  • Super-resolution microscopy:

    • Apply STORM or STED microscopy to visualize contact sites at nanoscale resolution

    • Quantify contact site number, size, and distribution in cells with manipulated FAM73B levels

  • Electron microscopy:

    • Perform transmission electron microscopy with gold immunolabeling for FAM73B

    • Measure the distance between mitochondria and ER membranes and quantify contact site frequency

  • Functional assays:

    • Measure phospholipid transfer between organelles using fluorescent lipid probes

    • Assess calcium transfer from ER to mitochondria using organelle-specific calcium indicators

  • Protein-protein interaction mapping:

    • Perform BioID or APEX2 proximity labeling with FAM73B as the bait

    • Identify proteins enriched at contact sites by mass spectrometry

  • Reconstitution approaches:

    • Create artificial membrane systems with purified recombinant FAM73B and VAP proteins

    • Measure tethering efficiency and membrane deformation

These methodological approaches provide complementary data on both the structural and functional aspects of FAM73B's role in organizing mitochondria-ER contact sites, distinguishing between direct and indirect effects.

What are common pitfalls when working with recombinant FAM73B and how can they be addressed?

Common challenges when working with recombinant FAM73B include:

ChallengeCauseSolution
Low expression yieldMembrane protein toxicity to expression hostUse inducible expression systems; optimize induction conditions (time, temperature); try specialized hosts like Expi293F cells
Protein misfoldingImproper disulfide bond formationInclude reducing agents during purification; optimize refolding conditions if needed
AggregationHydrophobic regions exposedAdd mild detergents (0.01-0.1% DDM or CHAPS); optimize buffer composition with stabilizing agents
Loss of activity during purificationHarsh conditions disrupting structureUse gentle purification methods; avoid harsh elution conditions; include stabilizing ligands
Inconsistent activity assaysVariability in phosphorylation statusImplement standardized phosphatase treatment or in vitro phosphorylation
Poor solubilityMembrane protein characteristicsUse appropriate detergents; consider protein engineering to improve solubility
Endotoxin contaminationExpression system contaminationUse endotoxin-free reagents; implement additional purification steps; test all preparations using LAL assay

Implementing these solutions will significantly improve the quality and consistency of recombinant FAM73B preparations for research applications.

How can contradictory data on FAM73B localization be reconciled in experimental design?

When faced with contradictory data on FAM73B localization:

  • Consider tissue-specific differences:

    • Different bovine tissues may exhibit varying FAM73B localization patterns

    • Design experiments that compare the same cell or tissue type across studies

  • Evaluate detection methods:

    • Compare antibody specificities using knockout/knockdown controls

    • Validate antibodies across multiple applications (western blot, immunofluorescence, immunoprecipitation)

    • Use orthogonal techniques (fractionation studies, APEX2 proximity labeling)

  • Assess tagging artifacts:

    • Test both N-terminal and C-terminal tags to identify potential interference

    • Validate tagged constructs with rescue experiments in knockout cells

    • Compare overexpression to endogenous protein levels

  • Consider dynamic localization:

    • Examine localization under different cellular conditions (nutrient status, stress)

    • Perform time-course experiments to detect translocation events

    • Correlate with post-translational modification status of potential FFAT motifs

  • Methodological harmonization:

    • Standardize fixation and permeabilization protocols

    • Use multiple microscopy techniques (widefield, confocal, super-resolution)

    • Implement quantitative colocalization analysis with appropriate statistical methods

This systematic approach allows researchers to determine whether contradictory data reflects biological variability or technical artifacts, leading to a more complete understanding of FAM73B's dynamic localization patterns.

What quality control measures should be implemented when using recombinant FAM73B in complex experimental systems?

Rigorous quality control measures for recombinant FAM73B include:

  • Purity assessment:

    • SDS-PAGE with Coomassie or silver staining (>95% purity)

    • Mass spectrometry to confirm protein identity and detect contaminants

    • Size exclusion chromatography to assess aggregation state

  • Functional verification:

    • Binding assays with known interaction partners like VAP proteins

    • Lipid binding assays if applicable

    • Activity assays specific to predicted molecular function

  • Structural integrity:

    • Circular dichroism to verify secondary structure

    • Thermal shift assays to assess stability

    • Limited proteolysis to evaluate proper folding

  • Modification status:

    • Phosphorylation analysis by mass spectrometry

    • Western blotting with phospho-specific antibodies

    • Other post-translational modifications that might affect function

  • Batch consistency:

    • Implement reference standards for inter-batch comparison

    • Perform lot-to-lot testing using standardized assays

    • Maintain detailed records of production conditions

  • Endotoxin testing:

    • LAL testing to ensure levels below 0.1 ng per μg protein

    • Test for other microbial contaminants if using mammalian systems

  • Storage stability:

    • Activity testing after freeze-thaw cycles

    • Long-term stability monitoring at different storage conditions

    • Accelerated stability testing when developing new formulations

How can recombinant FAM73B be used to study mitochondrial membrane protein interactions in reconstituted systems?

Reconstituted systems for studying FAM73B interactions:

  • Liposome-based approaches:

    • Incorporate purified recombinant FAM73B into liposomes mimicking mitochondrial outer membrane composition

    • Use fluorescently labeled liposomes to track membrane fusion/tubulation events

    • Implement FRET-based assays with labeled interaction partners

  • Nanodiscs and bicelles:

    • Embed FAM73B in nanodiscs with defined lipid composition

    • Better maintain native conformation compared to detergent-solubilized protein

    • Enable solution-based biophysical studies (NMR, SPR)

  • Giant unilamellar vesicles (GUVs):

    • Visualize membrane deformation induced by FAM73B using microscopy

    • Study interaction with VAP proteins in an in vitro membrane contact site model

    • Observe lipid domain organization influenced by FAM73B

  • Tethered bilayer lipid membranes (tBLMs):

    • Create supported membranes containing FAM73B

    • Enables electrical measurements and QCM-D studies

    • Provides stable platform for interaction studies

  • Microfluidic approaches:

    • Generate membrane tubules with defined curvature

    • Study preference of FAM73B for specific membrane geometries

    • Real-time monitoring of protein-protein interactions

These methodologies provide controlled environments to dissect the molecular mechanisms of FAM73B function, isolating specific interactions from the complexity of cellular systems while maintaining a membrane environment essential for proper protein function.

What are the methodological considerations for studying FAM73B in the context of mitochondrial disease models?

When studying FAM73B in mitochondrial disease models:

  • Model selection rationale:

    • Patient-derived cells for direct disease relevance

    • CRISPR-engineered cell lines with disease-specific mutations

    • Animal models (considering species differences in FAM73B function)

    • iPSC-derived specialized cell types (neurons, cardiomyocytes) for tissue-specific effects

  • FAM73B manipulation strategies:

    • Gene editing approaches (precise point mutations vs. knockout)

    • Conditional systems to avoid developmental compensation

    • Rescue experiments with wild-type and mutant variants

    • Dose-dependent manipulation (partial knockdown vs. complete knockout)

  • Phenotypic analysis framework:

    • Mitochondrial morphology (fragmentation, elongation, swelling)

    • Membrane potential and respiratory function measurements

    • ROS production and oxidative stress markers

    • Cell death pathways (apoptosis, necrosis, mitophagy)

    • Tissue-specific functional readouts

  • Molecular mechanism investigation:

    • Phosphorylation status of FFAT motifs in disease states

    • Altered protein-protein interactions using proximity labeling

    • Mitochondria-ER contact site quantification

    • Lipid transfer and calcium signaling assays

  • Therapeutic approach evaluation:

    • Small molecule screening targeting FAM73B interactions

    • Gene therapy approaches for correction

    • Metabolic bypass strategies

This methodological framework enables comprehensive evaluation of FAM73B's contribution to disease pathogenesis while distinguishing primary from secondary effects in complex disease models.

How can high-throughput approaches be applied to screen for compounds affecting FAM73B-dependent mitochondrial functions?

High-throughput screening strategies for FAM73B-targeting compounds:

  • Assay development and optimization:

    • Create cell lines with fluorescent reporters for mitochondrial morphology

    • Develop BRET/FRET biosensors for FAM73B interactions with VAP proteins or other partners

    • Establish phenotypic readouts in 384 or 1536-well format

    • Optimize for minimal variability (Z' factor > 0.5)

  • Compound libraries and screening strategy:

    Library TypeAdvantagesConsiderations
    FDA-approved drugsRepurposing potential, known safetyLimited chemical diversity
    Natural productsNovel scaffolds, bioactivityExtract deconvolution needed
    Focused librariesHigher hit rate, targetedMay miss unexpected mechanisms
    Diversity setsBroad chemical spaceLower hit rates expected
  • Primary screening approaches:

    • Image-based high-content screening for mitochondrial morphology

    • Reporter-based assays for mitochondrial function (membrane potential, ATP)

    • Protein-protein interaction disruption assays

    • Split-luciferase complementation for contact site formation

  • Hit validation cascade:

    • Dose-response confirmation

    • Counter-screens for non-specific effects

    • Orthogonal assays with different readouts

    • Target engagement verification (cellular thermal shift)

    • Structure-activity relationship studies

  • Advanced characterization:

    • Phosphoproteomics to assess impact on FFAT motif phosphorylation

    • Live-cell imaging to track dynamic effects

    • Respirometry for functional consequences

    • Pull-down assays with recombinant proteins to confirm direct binding

This comprehensive screening and validation approach enables identification of compounds that specifically modulate FAM73B function, potentially leading to both research tools and therapeutic candidates for mitochondrial disorders.

What are the most significant unanswered questions regarding bovine FAM73B function in mitochondrial biology?

Several critical questions remain unanswered regarding bovine FAM73B:

  • Molecular mechanism clarification: How does FAM73B precisely contribute to mitochondrial membrane dynamics at the structural level? Does it function as a scaffold, active membrane remodeler, or signaling hub?

  • Regulation network: What is the complete set of post-translational modifications (particularly phosphorylation of potential FFAT motifs ) that regulate FAM73B activity, and which kinases/phosphatases are responsible?

  • Interactome mapping: What is the complete protein interaction network of FAM73B, especially regarding VAP proteins and other tethering complexes at mitochondria-ER contact sites?

  • Tissue-specific functions: Does FAM73B exhibit differential functions or regulation across various bovine tissues with different metabolic demands?

  • Pathological relevance: How do alterations in FAM73B contribute to mitochondrial dysfunction in disease states, and can it serve as a therapeutic target?

Addressing these questions will require integrative approaches combining structural biology, systems biology, and advanced imaging techniques to fully elucidate FAM73B's role in mitochondrial biology.

How can comparative studies between bovine and human FAM73B inform translational research?

Comparative studies between bovine and human FAM73B offer valuable translational insights:

  • Evolutionary conservation analysis:

    • Identify highly conserved domains indicating essential functions

    • Map species-specific variations that might reflect specialized adaptations

    • Use conservation patterns to predict critical functional residues

  • Structural and functional comparative approach:

    • Compare phosphorylation profiles of FFAT motifs between species

    • Assess differences in interaction partners, particularly with VAP proteins

    • Evaluate differential responses to cellular stressors

  • Cross-species experimental design:

    • Perform rescue experiments with bovine FAM73B in human cells with FAM73B knockdown

    • Create chimeric proteins to identify functionally divergent domains

    • Develop antibodies recognizing conserved epitopes for cross-species studies

  • Translational implications assessment:

    • Determine if bovine models accurately reflect human mitochondrial biology

    • Identify areas where species differences might limit translational relevance

    • Develop bovine-specific tools that could eventually be adapted for human studies

This comparative approach leverages evolutionary insights to accelerate translational research while identifying important species-specific considerations for experimental design and interpretation.

What methodological advances are needed to better understand FAM73B's role in mitochondrial membrane dynamics?

Addressing gaps in FAM73B research requires methodological innovations:

  • Structural biology approaches:

    • Cryo-EM structures of FAM73B in membrane environments

    • Hydrogen-deuterium exchange mass spectrometry for dynamic structural analysis

    • Single-molecule techniques to observe conformational changes

  • Advanced imaging technologies:

    • Super-resolution live-cell imaging to track FAM73B dynamics at nanoscale

    • Correlative light and electron microscopy to connect function with ultrastructure

    • Lattice light-sheet microscopy for high-speed 3D visualization of mitochondrial dynamics

  • Protein engineering strategies:

    • Split fluorescent protein systems specifically designed for membrane proteins

    • Photoswitchable tags for pulse-chase imaging of FAM73B populations

    • Proximity labeling optimized for mitochondrial membrane environments

  • Biochemical and biophysical tools:

    • Reconstituted membrane systems that better mimic mitochondrial outer membrane

    • Force spectroscopy to measure membrane deformation capabilities

    • Improved detergents or nanodiscs for maintaining native conformation

  • Systems biology integration:

    • Multi-omics approaches linking FAM73B modifications to functional outcomes

    • Mathematical modeling of mitochondrial dynamics incorporating FAM73B parameters

    • AI-assisted image analysis for detecting subtle phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.