Recombinant Bovine Protein MAL2 (MAL2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
MAL2; Protein MAL2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
MAL2
Target Protein Sequence
MSAGGAPVPPPPNPAMSFPAPRVTLPAGPDILRTYSGAFVCLEIVFGGLVWILVASSNVP LPLLQGWVMFVSVTAFVCSLLFLGVFLSGVVTQINANWNFLDFAYHFTVFVFYFGAFLLE AATTSLHDLRCNRTMTVQPLLSDNQYNINVAATIFAFVTTACYGCSLGLALRRWRP
Uniprot No.

Target Background

Function
MAL2 is a member of the machinery responsible for polarized transport. It is essential for the indirect transcytotic route, specifically in the egress of transcytosing cargo from perinuclear endosomes. This allows the cargo to travel to the apical surface via a raft-dependent pathway.
Database Links
Protein Families
MAL family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Apical cell membrane; Multi-pass membrane protein.

Q&A

What is MAL2 and what cellular functions does it perform?

MAL2 is a member of the MAL protein family that functions in specialized membrane microdomains. The protein plays a critical role in polarized protein sorting and vesicular trafficking in epithelial cells. At the molecular level, MAL2 appears to mediate connections between membrane microdomains and the actin cytoskeleton . Research shows that MAL2 is normally expressed in polarized epithelial cells where it facilitates indirect transcytosis, a process by which newly-synthesized apical plasma membrane proteins are first delivered to the basolateral domain before being redistributed to the apical surface .

What is the cellular localization pattern of MAL2?

In polarized cells, MAL2 displays a dynamic localization pattern following the indirect pathway of protein delivery. Studies tracking MAL2 distribution show it moves from the ER and Golgi (biosynthetic pathway) to the basolateral membrane, then to a sub-apical compartment (SAC), and finally to the apical domain where it resides at steady state . When expressed in non-polarized cells, MAL2 follows a similar trafficking route but ultimately localizes to what researchers term the "apical compartment," which is an intracellular structure that contains apical membrane proteins in non-polarized cells .

Is there a relationship between MAL2 expression and cancer progression?

Contrary to what might be expected from chromosome 8q24 amplification (where MAL2 resides), MAL2 protein levels are significantly decreased in malignant tissues compared to benign tissues in hepatocellular carcinoma (HCC), cholangiocarcinoma (CC), and renal cell carcinoma (RCC) . This decrease in protein expression, coupled with MAL2's ability to suppress cell migration and invasion, suggests that MAL2 may function as a tumor suppressor. This creates what researchers call the "MAL2 Paradox," where transcript levels may be increased but protein levels are decreased during cancer progression .

What are the recommended approaches for studying MAL2 expression in experimental systems?

For studying MAL2 in experimental systems, researchers have successfully employed several approaches:

  • Overexpression systems: Use of recombinant adenoviruses expressing C-terminally FLAG-tagged wild type MAL2 has proven effective in polarized cell models like WIF-B cells .

  • RNA interference: siRNA knockdown targeting MAL2 has been successfully implemented in cells with endogenous MAL2 expression, such as Hep3B hepatocellular carcinoma cells .

  • Protein detection: Immunohistochemistry using analytically validated antibodies for clinical applications has been employed to detect MAL2 protein levels in human tissue samples .

  • Expression in null backgrounds: Expression of MAL2 in cells lacking endogenous expression (like Clone 9 hepatoma cells) provides a clean system to study MAL2 function without interference from endogenous protein .

What cell models are most appropriate for studying MAL2 function?

Based on published research, several hepatic cell models have proven useful for studying MAL2:

  • WIF-B cells: Polarized, differentiated cells with endogenous MAL2 expression that provide a model for studying MAL2 in a fully polarized context .

  • Hep3B cells: Hepatocellular carcinoma-derived cells with endogenous MAL2 expression that are useful for studying the effects of MAL2 knockdown .

  • Clone 9 cells: Hepatoma-derived cells that lack endogenous MAL2 expression, providing a null background for expressing wild-type or mutant MAL2 proteins .

Each model offers distinct advantages depending on the research question being addressed.

How can researchers track MAL2 trafficking in living cells?

To study MAL2 trafficking, researchers have employed cycloheximide (CHX) chase experiments. By treating cells with 50 μg/mL of cycloheximide for up to 4 hours, researchers can block new protein synthesis and track the movement of a newly-synthesized cohort of MAL2 through the biosynthetic pathway . This approach has revealed that MAL2 follows the indirect route to the apical surface in polarized cells, moving from the ER/Golgi to the basolateral surface, then to the sub-apical compartment, and finally to the apical domain .

How does MAL2 influence actin-based protrusion formation?

MAL2 expression promotes the formation of filopodia-like actin-based protrusions at the cell surface. In HCC-derived Hep3B cells with endogenous MAL2 expression, numerous cell surface protrusions are observed with MAL2 detected at their tips . When MAL2 is knocked down, these cells display approximately 70% fewer protrusions and exhibit a more cuboidal phenotype . Similarly, when MAL2 is expressed in Clone 9 cells (which lack endogenous MAL2), the cells lose their cuboidal morphology and form long, actin-based filopodia-like protrusions with MAL2 localized to the tips .

What molecular motifs in MAL2 are critical for its effect on actin dynamics?

Mutational analysis has revealed that a putative Ena/VASP homology 1 (EVH1) recognition motif in the cytoplasmically-oriented N-terminal domain of MAL2 is critical for its effect on actin dynamics. Specifically, MAL2 contains VPPPP and FPAP sequences that resemble the F/L/W/YPPPP recognition sites for EVH1 motifs present in Ena/VASP proteins . When the FPAP motif is mutated to alanines, MAL2-induced protrusion formation is abolished, whereas mutation of the VPPPP motif has no effect . This indicates that the FPAP motif specifically mediates MAL2's ability to induce actin-based protrusion formation.

What is the relationship between MAL2-induced protrusions and invadopodia formation?

Research suggests an inverse relationship between MAL2-induced filopodia-like protrusions and invasive structures like invadopodia. When MAL2 is expressed, cells form numerous filopodia-like protrusions but show decreased invasion capacity . Conversely, when MAL2 expression is reduced, cells display circular, dorsal ruffle-like structures reminiscent of invadopodia and show enhanced invasiveness . This suggests that MAL2 may promote filopodia formation at the expense of invadopodia and/or lamellipodia formation, potentially by redirecting actin and actin-binding proteins away from ventral invadopodia sites to the lateral edges of the cell .

Why is there a discrepancy between MAL2 transcript and protein levels in cancer?

The "MAL2 Paradox" refers to the observation that MAL2 transcript levels are often increased in epithelial-derived cancers, while protein levels are decreased. A proposed model to explain this discrepancy suggests that in HCC and CC, chromosome 8q24 amplification initially leads to enhanced expression of both MAL2 and c-Myc . As cancer progresses, c-Myc expression is further enhanced, leading to Miz1 transcriptional repression and loss of Miz1-specific target expression—including MAL2 . Thus, enhanced MAL2 expression may be associated with earlier stages of cancer progression, while its expression is repressed during later stages and in metastases as c-Myc protein expression increases .

How does MAL2 expression affect cancer cell behavior?

MAL2 expression has several effects on cancer cell behavior:

  • Migration: MAL2 overexpression leads to decreased cell migration in scratch assays. Hep3B cells with MAL2 knockdown show approximately 75% closure of the scratch area after 18 hours, compared to only about 40% closure in control cells .

  • Invasion: MAL2 expression inhibits cell invasion through Matrigel. Cells with MAL2 knockdown show enhanced invasion capacity, while cells overexpressing MAL2 show reduced invasion .

  • Proliferation: MAL2 has a more modest effect on cell proliferation, with cells overexpressing MAL2 showing slightly decreased viability compared to control cells .

These findings collectively suggest that MAL2 functions in an anti-oncogenic capacity by inhibiting cell behaviors associated with cancer progression and metastasis.

What experimental assays are useful for studying MAL2's effects on cancer cell behavior?

Several assays have proven useful for studying MAL2's effects on cancer cell behavior:

  • Scratch assays: To measure cell migration, researchers create a "scratch" in a monolayer of cells and monitor gap closure over time, typically at 6, 12, and 18 hours .

  • Matrigel invasion assays: To assess invasion capacity, cells are seeded onto Matrigel-coated transwell inserts and allowed to invade through the matrix toward a chemoattractant .

  • MTT assays: To evaluate cell proliferation, researchers seed cells onto 96-well plates and measure viability after several days using the MTT assay .

  • Microscopic analysis of cell morphology: High-magnification imaging of cells at the leading edge of a scratch allows for quantification of cell surface protrusions and assessment of morphological changes .

What molecular mechanisms underlie MAL2's role in actin remodeling?

Several lines of evidence suggest that MAL2 coordinates with actin-binding proteins to regulate both protein sorting in polarized cells and protrusion formation in non-polarized cells:

  • MAL2 redistributes from the apical membrane to sub-apical puncta upon depolymerization of the cortical actin web .

  • Inverted formin 2 (INF2), which regulates actin dynamics, has been identified as a MAL2 binding partner .

  • MAL2 may coordinate with serine threonine kinase 16 and the actin-binding protein WD repeat-containing protein 1 to regulate secretory vesicle docking and fusion .

  • The EVH1 recognition motif in MAL2 suggests interaction with Ena/VASP proteins, which drive barbed-end actin filament assembly and filopodia formation .

These interactions collectively suggest that MAL2 functions at the interface between membrane trafficking and the actin cytoskeleton.

How might the anti-oncogenic properties of MAL2 be leveraged for therapeutic approaches?

Given MAL2's anti-oncogenic properties, several therapeutic approaches might be considered:

  • Restoring MAL2 expression: Since MAL2 protein levels are decreased in various carcinomas despite chromosome 8q24 amplification, strategies to restore MAL2 protein expression might inhibit cancer progression .

  • Targeting the MAL2-actin interface: The identification of the FPAP motif as critical for MAL2's effect on actin remodeling suggests that small molecules mimicking this interaction might promote anti-oncogenic actin remodeling .

  • Modulating the c-Myc/Miz1/MAL2 axis: Understanding the transcriptional regulation of MAL2 by the c-Myc/Miz1 axis might reveal opportunities to restore MAL2 expression by targeting this pathway .

What are the current limitations in our understanding of MAL2 function?

Despite significant advances in understanding MAL2 function, several important questions remain:

  • Molecular mechanism of protrusion formation: While MAL2 clearly promotes filopodia-like protrusion formation, the precise molecular mechanisms by which it influences actin dynamics remain incompletely understood .

  • Temporal relationship in cancer progression: The proposed model for the "MAL2 Paradox" suggests temporal changes in MAL2 expression during cancer progression, but this requires systematic analysis of MAL2, c-Myc, and Miz1 expression patterns in tumors of increasing grade .

  • Functional consequences of protrusion formation: It remains unclear exactly why MAL2-induced protrusions are associated with decreased migration and invasion. One possibility is that MAL2 induces more adhesive filopodia at the expense of more motile Arp2/3-rich lamellipodia .

Addressing these questions will require integrative approaches combining structural biology, advanced imaging, and in vivo models of cancer progression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.