Recombinant Bovine Protein NKG7 (NKG7)

Shipped with Ice Packs
In Stock

Description

3.2. Applications in Immunology Research

Recombinant Bovine NKG7 serves as a tool for:

  1. Antibody validation: Used as a positive control in Western blot assays for species-specific NKG7 detection .

  2. Functional studies: Enables exploration of NKG7’s role in lymphocyte cytotoxicity and lysosomal regulation in bovine models .

  3. Therapeutic development: Insights from human studies suggest NKG7 overexpression enhances CD8+ T cell tumor infiltration and survival , guiding analogous research in veterinary oncology.

4.1. Biomarker Potential

Human NKG7 expression correlates with improved survival in bladder cancer (HR: 0.49, p < 0.0001) . While bovine-specific clinical data are lacking, conserved mechanisms suggest diagnostic relevance in cattle diseases like bovine leukemia virus (BLV) or mastitis.

4.2. Challenges and Future Directions

  • Species-specific variability: Functional differences between bovine and human NKG7 remain uncharacterized.

  • Therapeutic targeting: Small-molecule modulators of NKG7-v-ATPase interactions could enhance livestock immunity .

References

  1. Lysosomal NKG7 restrains mTORC1 activity to promote CD8+ T cell durability (Nature Communications, 2025)

  2. NKG7 Antibody specifications (Assay Genie, 2000)

  3. Clinical prognostic value of NKG7 in bladder cancer (PMC, 2025)

  4. NKG7 enhances CD8+ T cell synapse efficiency (PMC, 2022)

  5. NKG7 regulates cytotoxic granule exocytosis (PMC, 2020)

  6. Recombinant Bovine NKG7 product details (Creative Biomart, 2025)

  7. NKG7 as a pan-cytotoxicity marker (bioRxiv, 2025)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
NKG7; Protein NKG7; Natural killer cell protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
NKG7
Target Protein Sequence
MEPCRSLALLTSSLGLVSLLVAVSTNFWFAARGPGFSSHSGLWPSKDQVSVAGYIHVTQS FCILAVLWGLISTAFLVMSCIPSLSAPGRGPIVSTFMGFAGALSLIVAMTVYTIERWNQP ANPQVQSFFSWSFYLGWVSTLLFLCTGGLSLGAHCTTHRPDYEAV
Uniprot No.

Target Background

Database Links
Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytolytic granule membrane; Multi-pass membrane protein.

Q&A

What is NKG7 and what cellular compartments contain it?

NKG7 (also known as GIG1, GMP-17, or p15-TIA-1) is a granule membrane protein originally identified in Natural Killer cells and cytotoxic T lymphocytes. Research demonstrates that NKG7 primarily localizes to lysosomal membranes where it regulates granule exocytosis and downstream inflammatory pathways . Expression studies using reporter mice show that at steady state, NKG7 is predominantly expressed in NK cells and a subset of CD8+ T cells, with relatively minimal expression by CD4+ T cells and other immune cell subsets in naive mice .

For proper recombinant bovine NKG7 localization studies, researchers should:

  • Use LAMP1 co-staining to confirm lysosomal localization

  • Employ subcellular fractionation to isolate membrane-bound versus cytosolic protein

  • Validate targeting with lysosomal inhibitors such as Bafilomycin A1

Immunofluorescence microscopy reveals that NKG7 affects lysosomal morphology, with NKG7-knockout resulting in aggregated/enlarged lysosomes with fewer numbers, while overexpression leads to smaller, more numerous lysosomes with dispersed distribution .

How is NKG7 expression regulated in different immune cell types?

NKG7 expression is differentially regulated across immune cell populations and activation states. Research indicates specific patterns that researchers should consider when studying bovine systems:

  • Cell type specificity: At steady state, Nkg7 expression is highest in NK cells followed by CD8+ T cells, with minimal expression in resting CD4+ T cells .

  • Cytokine regulation: NKG7 expression increases under TH1 polarizing conditions and is further amplified by IL-27 to generate Tr1 cells. Importantly, TGF-β suppresses NKG7 expression in a dose-dependent manner without affecting cell viability .

  • Infection-induced changes: During Leishmania donovani infection in mice, CD4+ and CD8+ T cells emerge as the main NKG7-expressing cells after day 14 post-infection, demonstrating contextual regulation .

For researchers studying bovine NKG7, designing experiments to examine expression under different polarizing conditions is essential. Methodologically, establish baseline expression in resting cells before assessing changes during activation or infection challenges.

What methods are most effective for detecting and quantifying recombinant bovine NKG7?

When working with recombinant bovine NKG7, researchers should implement a multi-modal detection strategy:

Protein-level detection:

  • Western blotting with antibodies reactive to conserved epitopes (potential cross-reactivity with human or mouse antibodies should be tested)

  • Flow cytometry for cellular expression profiling

  • ELISA-based quantification (detection range for mouse NKG7: 0.312-20 ng/mL; sensitivity: <0.156 ng/mL)

Gene expression analysis:

  • RT-qPCR with bovine-specific primers

  • RNA-seq for whole transcriptome profiling

  • Single-cell RNA-seq for cell population heterogeneity assessment

Recombinant protein tracking:

  • Construct epitope-tagged versions (His, FLAG, etc.) for purification and detection

  • Consider fluorescent fusion proteins for live-cell imaging

  • Validate that tagging does not interfere with localization or function

When establishing new detection assays, researchers should include appropriate positive controls (e.g., stimulated NK cells) and negative controls (e.g., non-immune cells) to validate specificity.

How can researchers design functional assays to assess recombinant bovine NKG7 activity?

Based on established mechanisms of NKG7 function, researchers can implement the following assays to assess recombinant bovine NKG7 activity:

Lysosomal morphology assessment:

  • Express recombinant NKG7 in appropriate cell lines lacking endogenous NKG7

  • Immunostain for LAMP1 to visualize lysosomes

  • Quantify changes in lysosome size, number, and distribution

  • Expected outcome: NKG7 expression should result in smaller, more numerous, dispersed lysosomes

v-ATPase assembly analysis:

  • Implement proximity ligation assays (PLA) between V0 subunit (e.g., ATP6V0a4) and V1 subunit (e.g., ATP6V1B1)

  • Quantify PLA puncta representing assembled v-ATPase complexes

  • Expected outcome: NKG7 expression should reduce the number of PLA puncta

Membrane fraction analysis:

  • Perform subcellular fractionation to separate membrane and cytosolic components

  • Compare V1 domain subunit presence in membrane fractions with and without NKG7

  • Expected outcome: NKG7 expression should reduce V1 domain subunits in membrane fractions

mTORC1 signaling assessment:

  • Measure phosphorylation of mTORC1 targets (S6K, 4E-BP1)

  • Compare signaling in the presence and absence of NKG7

  • Expected outcome: NKG7 expression should reduce mTORC1 signaling

How does NKG7 regulate v-ATPase assembly and what are the implications for lysosomal function?

NKG7 serves as a critical regulator of v-ATPase assembly and function, with downstream effects on lysosomal acidification and mTORC1 signaling. Researchers working with recombinant bovine NKG7 should understand these mechanisms:

Mechanism of v-ATPase regulation:

  • NKG7 physically interacts with the V0 domain of v-ATPase

  • This interaction prevents proper association between the V0 (membrane) and V1 (cytosolic) domains of v-ATPase

  • Proximity ligation assays (PLA) demonstrate that NKG7 expression reduces the number of V0-V1 interactions

  • Membrane fractionation studies show NKG7 reduces recruitment of V1 domain subunits to membrane fractions

Functional consequences:

  • Reduced v-ATPase assembly leads to decreased lysosomal acidification

  • This impacts lysosomal enzyme activity and cargo degradation

  • Altered lysosomal pH affects recruitment of signaling complexes, particularly the Ragulator complex

Experimental approach for bovine studies:
When investigating bovine NKG7's impact on v-ATPase, researchers should assess:

  • Direct protein-protein interactions using co-immunoprecipitation or PLA

  • Changes in lysosomal pH using ratiometric pH-sensitive probes

  • Alterations in lysosomal enzyme activity as functional readouts

What is the relationship between NKG7 and mTORC1 signaling in immune cells?

NKG7 functions as a negative regulator of mTORC1 activity through its effects on v-ATPase and the Ragulator complex. Understanding this relationship is crucial for researchers studying immune cell metabolism and memory development:

Signaling pathway interactions:

  • NKG7 reduces v-ATPase assembly and function

  • This affects interaction between v-ATPase and the Ragulator complex (LAMTOR1-5)

  • Impaired recruitment of LAMTOR1 to lysosomes disrupts Rag GTPase activation

  • Consequently, mTORC1 recruitment to lysosomes and its activation are reduced

Functional outcomes in immune cells:

  • Human and mouse CD8+ T cells lacking NKG7 show increased mTORC1 signaling

  • This altered signaling affects effector CD8+ T cell durability and memory precursor formation

  • NKG7 deletion results in fewer memory T cells following infection

Methodological considerations for bovine studies:
To investigate this pathway in bovine cells, researchers should:

  • Assess mTORC1 activity by measuring phosphorylation of S6K and 4E-BP1

  • Evaluate LAMTOR1 localization by immunofluorescence microscopy

  • Use mTOR inhibitors (rapamycin, Torin1) as controls

  • Compare responses in primary bovine immune cells and cell lines

How does NKG7 expression change during infection and what are the implications for immune responses?

NKG7 expression is dynamically regulated during infection, with important implications for immune response outcomes. Researchers studying bovine infectious diseases should consider these patterns:

Temporal expression changes:

  • In Leishmania donovani infection, NKG7 expression increases in CD4+ T cells by day 14 post-infection

  • CD4+ and CD8+ T cells emerge as the main NKG7-expressing cells after this timepoint

  • This represents a shift from steady-state where NK cells are the predominant expressors

Impact on infection outcomes:

  • NKG7-deficient mice show impaired control of L. donovani parasite growth in both liver and spleen

  • Serum levels of key pro-inflammatory cytokines (IFN-γ, TNF) are significantly reduced

  • Infection fails to resolve in NKG7-deficient animals by day 56 post-infection

Infection-specific effects:

  • In a cerebral malaria model (P. berghei ANKA), NKG7-deficient mice are protected from severe neurological disease

  • This protection is associated with reduced CD8+ T cell recruitment and activation in the brain

Methodological recommendations:
When studying bovine infection models, researchers should:

  • Track NKG7 expression kinetics across multiple timepoints

  • Assess expression in multiple immune cell populations

  • Correlate expression with both protective immunity and immunopathology markers

How does NKG7 affect CD8+ T cell memory development and what are the implications for vaccine design?

NKG7 plays a crucial role in CD8+ T cell memory formation through its regulation of mTORC1 signaling, with significant implications for vaccine development:

Impact on T cell memory:

  • NKG7-deleted effector CD8+ T cells show reduced durability following LCMV infection

  • These cells generate fewer memory precursors compared to wild-type cells

  • Conversely, induced expression of NKG7 in CD8+ T cells results in increased presence of intra-tumoral T cells

Mechanistic basis:

  • NKG7 restrains mTORC1 activity in CD8+ T cells

  • This metabolic regulation supports the transition from effector to memory phenotype

  • Excessive mTORC1 activity in NKG7-deficient cells may promote terminal differentiation at the expense of memory formation

Applications for bovine vaccine research:
Researchers developing bovine vaccines should consider:

  • Monitoring NKG7 expression as a potential biomarker for memory T cell development

  • Evaluating adjuvants for their ability to modulate NKG7 expression

  • Investigating genetic variation in bovine NKG7 as a potential factor in vaccine responsiveness

Experimental approaches:
To study NKG7's role in bovine memory formation:

  • Track NKG7 expression during primary and recall responses

  • Compare memory cell formation in cells with modulated NKG7 levels

  • Correlate NKG7 expression with established memory markers

What expression systems are optimal for producing functional recombinant bovine NKG7?

Selecting the appropriate expression system is crucial for obtaining functional recombinant bovine NKG7. Based on the protein's characteristics, researchers should consider:

Mammalian expression systems:

  • HEK293T or CHO cells provide proper post-translational modifications

  • Advantageous for maintaining proper membrane protein folding

  • Can incorporate inducible promoters for controlled expression

  • Consider using CD8-NKG7 transgenic construct approaches similar to those used in mouse models

Insect cell systems:

  • Baculovirus-infected Sf9 or High Five cells offer good yields

  • Intermediate between bacterial and mammalian systems in terms of post-translational modifications

  • Suitable for membrane proteins with complex folding requirements

Cell-free systems:

  • Can be optimized for membrane protein expression

  • Allow incorporation of specific lipid environments

  • Rapid production but potentially lower yields

Critical parameters for functional expression:

  • Include proper signal sequences for membrane targeting

  • Consider fusion tags that don't interfere with membrane insertion

  • Validate cellular localization to lysosomes

  • Confirm interaction with v-ATPase components

For any expression system, researchers should validate that the recombinant protein replicates the known functions of native NKG7, particularly its effects on lysosomal morphology and v-ATPase assembly.

How can researchers validate the proper folding and function of recombinant bovine NKG7?

Validating proper folding and function of recombinant bovine NKG7 requires multiple complementary approaches:

Structural validation:

  • Circular dichroism to assess secondary structure content

  • Limited proteolysis to evaluate conformational integrity

  • Size exclusion chromatography to assess aggregation state

  • Thermal stability assays to measure protein stability

Functional validation:

  • Lysosomal morphology assessment in transfected cells:

    • Expected outcome: smaller, more numerous lysosomes

  • v-ATPase assembly analysis:

    • Expected outcome: reduced V0-V1 association measured by PLA

  • Membrane fractionation analysis:

    • Expected outcome: reduced V1 domain in membrane fractions

  • mTORC1 signaling assessment:

    • Expected outcome: reduced phosphorylation of mTORC1 targets

Interaction studies:

  • Co-immunoprecipitation with v-ATPase components

  • Surface plasmon resonance to measure binding kinetics

  • Proximity ligation assays in cellular contexts

A comprehensive validation approach should include multiple assays, with appropriate positive controls (wild-type NKG7) and negative controls (non-functional mutants or irrelevant proteins).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.